Centrin-2 Protein, Human (HEK293, His)
Centrin-2 protein plays a critical role in microtubule-organized centromere structure, directing centriole duplication, spindle formation, and regulation of cytokinesis. It ensures genome stability by interacting with CALM1 and CCP110. Centrin-2 Protein, Human (HEK293, His) is the recombinant human-derived Centrin-2 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Centrin-2 protein plays a critical role in microtubule-organized centromere structure, directing centriole duplication, spindle formation, and regulation of cytokinesis. It ensures genome stability by interacting with CALM1 and CCP110. Centrin-2 Protein, Human (HEK293, His) is the recombinant human-derived Centrin-2 protein, expressed by HEK293 , with C-His labeled tag.
Background
Centrin-2 Protein assumes a fundamental role in the structure and function of the microtubule organizing center, particularly in centriole duplication and the proper formation of spindles during cell division. Beyond its central role in these processes, Centrin-2 contributes to the regulation of cytokinesis and maintenance of genome stability through collaborative interactions with CALM1 and CCP110. Additionally, it is intricately involved in global genome nucleotide excision repair (GG-NER) by acting as a crucial component of the XPC complex. In partnership with RAD23B, Centrin-2 appears to stabilize XPC, and in vitro, it stimulates the DNA binding of the XPC:RAD23B dimer, highlighting its multifaceted involvement in cellular mechanisms essential for genomic integrity and cell division.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P41208 (M1-Y172)
-
Molecular Construction
-
N-term
-
Centrin-2 (M1-Y172)
Accession # P41208 -
His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
CETN2; Centrin, EF-Hand Protein, 2; Prev. CALT; Caltractin (20kD Calcium-Binding Protein); CEN2; Caltractin Isoform 1; Centrin 2; Centrin-2
-
AA Sequence
MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY
-
Predicted Molecular Mass
21.2 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
