CEP55 Protein, Human (His, Strep)

CEP55 Protein, Human (His, Strep) is the recombinant human-derived CEP55, expressed by E. coli , with Strep, His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CEP55 Protein, Human (His, Strep) is the recombinant human-derived CEP55, expressed by E. coli , with Strep, His labeled tag.

Background

CEP55 plays a crucial role in mitotic exit and cytokinesis. It recruits PDCD6IP and TSG101 to the midbody during cytokinesis, ensuring the successful completion of this process. While not required for microtubule nucleation, CEP55 is involved in the development of the brain and kidney.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Strep;His
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    CEP55; Centrosomal Protein 55kDa; Prev. C10orf3; URCC6; Centrosomal Protein Of 55 KDa; Chromosome 10 Open Reading Frame 3; CT111; MARCH; Up-Regulated In Colon Cancer 6; Cep55; Cancer/Testis Antigen 111; Centrosomal Protein 55; FLJ10540

  • AA Sequence

    APNCFNSSINNIHEMEIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFELEKKTETAAHSLP

  • Predicted Molecular Mass

    10.2 kDa

  • Purity

    ≥ 80%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00