1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. CG-alpha
  5. CG alpha Protein, Human (HEK293, mFc)

The CG alpha protein, a shared alpha chain in glycoprotein hormones (TSH, LH, FSH, CG), binds to receptors, initiating signaling pathways. Heterodimeric hormones involve CG alpha and a specific beta chain (TSHB, LHB, FSHB, CGB), imparting biological specificity. CG alpha Protein, Human (HEK293, mFc) is the recombinant human-derived CG alpha protein, expressed by HEK293 , with C-mFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CG alpha protein, a shared alpha chain in glycoprotein hormones (TSH, LH, FSH, CG), binds to receptors, initiating signaling pathways. Heterodimeric hormones involve CG alpha and a specific beta chain (TSHB, LHB, FSHB, CGB), imparting biological specificity. CG alpha Protein, Human (HEK293, mFc) is the recombinant human-derived CG alpha protein, expressed by HEK293 , with C-mFc labeled tag.

Background

The CG alpha protein serves as the shared alpha chain in the active heterodimeric glycoprotein hormones, including thyrotropin (TSH), lutropin (LH), follitropin (FSH), and choriogonadotropin (CG). These hormones bind to specific receptors on target cells, initiating downstream signaling pathways. The heterodimeric structure of these hormones involves the CG alpha chain, as described here, and a unique beta chain, which imparts biological specificity to each hormone. Specifically, TSH consists of CG alpha and TSH beta (TSHB), lutropin comprises CG alpha and LH beta (LHB), follitropin includes CG alpha and FSH beta (FSHB), and choriogonadotropin is composed of CG alpha and choriogonadotropin subunit beta (CGB).

Species

Human

Source

HEK293

Tag

C-mFc

Accession

P01215 (A25-S116)

Gene ID
Molecular Construction
N-term
CG alpha (A25-S116)
Accession # P01215
mFc
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Glycoprotein hormones alpha chain; CG-alpha; FSH-alpha; CGA
AA Sequence

APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

Predicted Molecular Mass
36.6 kDa
Molecular Weight

Approximately 46 kDa, based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CG alpha Protein, Human (HEK293, mFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CG alpha Protein, Human (HEK293, mFc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CG alpha Protein, Human (HEK293, mFc)
Cat. No.:
HY-P75341
Quantity:
MCE Japan Authorized Agent: