CH25H Protein, Mouse (Cell-Free, His)
- Species: Mouse
- Source: E. coli Cell-free
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Technical Parameters
-
Species Mouse
-
Source E. coli Cell-free
-
Tag N-10*His
-
Accession
Q9Z0F5 (M1-T298)
-
Gene ID12642
-
Protein Length
Full Length
-
Synonyms
CH25H; H25OH; Cholesterol 25-Hydroxylase; C25H; Cholesterol 25-Monooxygenase
-
AA Sequence
MGCYNGSELQDLGCSSQLLLQPLWDTIRTREAFTRSPIFPVTFSIITYVGFCLPFVVLDVLYPWVPILRRYKIHPDFSPSVKQLLPCLGLTLYQHLVFVFPVTLLHWVRSPALLPQEAPELVQLLSHVLICLLLFDTEIFAWHLLHHKVPWLYRTFHKVHHQNSSSFALATQYMSFWELLSLTFFDVLNVAVLRCHPLTIFTFHVINIWLSVEDHSGYDFPWSTHRLVPFGWYGGVAHHDMHHSQFNCNFAPYFTHWDKMLGTLRSAPLPESLCACGERCVNSRERCAVHLIQKKKQT
-
Predicted Molecular Mass
36.2 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
