1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. CHAC1 Protein, Human (His, Strep)

The CHAC1 protein cleaves glutathione, inducing apoptosis via the ATF4-ATF3-DDIT3/CHOP cascade. It acts as a negative regulator of the Notch signaling pathway, promoting neurogenesis by inhibiting Notch cleavage. CHAC1 Protein, Human (His, Strep) is the recombinant human-derived CHAC1 protein, expressed by E. coli , with C-Strep, N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CHAC1 protein cleaves glutathione, inducing apoptosis via the ATF4-ATF3-DDIT3/CHOP cascade. It acts as a negative regulator of the Notch signaling pathway, promoting neurogenesis by inhibiting Notch cleavage. CHAC1 Protein, Human (His, Strep) is the recombinant human-derived CHAC1 protein, expressed by E. coli , with C-Strep, N-6*His labeled tag.

Background

CHAC1, a key player in cellular processes, catalyzes the cleavage of glutathione into 5-oxo-L-proline and a Cys-Gly dipeptide, exhibiting specificity for glutathione over other gamma-glutamyl peptides. Its enzymatic action on glutathione is crucial as glutathione depletion is a significant factor in apoptosis initiation and execution. CHAC1 further serves as a pro-apoptotic component within the unfolded protein response pathway, mediating the effects of the ATF4-ATF3-DDIT3/CHOP cascade. Additionally, CHAC1 functions as a negative regulator of the Notch signaling pathway, impacting embryonic neurogenesis by inhibiting Notch cleavage through furin. This inhibition maintains Notch in an immature, inactive form, thereby promoting neurogenesis in embryos.

Species

Human

Source

E. coli

Tag

N-6*His;C-Strep

Accession

Q9BUX1 (K2-V222)

Gene ID

79094

Molecular Construction
N-term
Strep-6*His
CHAC1 (K2-V222)
Accession # Q9BUX1
C-term
Protein Length

Partial

Synonyms
CHAC1; Glutathione-specific gamma-glutamylcyclotransferase 1; Gamma-GCG 1; Blocks Notch protein; Botch; Cation transport regulator-like protein 1
AA Sequence

KQESAAPNTPPTSQSPTPSAQFPRNDGDPQALWIFGYGSLVWRPDFAYSDSRVGFVRGYSRRFWQGDTFHRGSDKMPGRVVTLLEDHEGCTWGVAYQVQGEQVSKALKYLNVREAVLGGYDTKEVTFYPQDAPDQPLKALAYVATPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQDEHLAAIVDAVGTMLPCFCPTEQALALV

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CHAC1 Protein, Human (His, Strep) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CHAC1 Protein, Human (His, Strep)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CHAC1 Protein, Human (His, Strep)
Cat. No.:
HY-P701946
Quantity:
MCE Japan Authorized Agent: