CIAO1 Protein, Human

CIAO1 protein is a key player in the cytosolic iron-sulfur protein assembly (CIA) complex, interacting with CIAO2A or CIAO2B and MMS19 to affect different iron-sulfur protein assembly pathways. The CIAO1:CIAO2B:MMS19 assembly facilitates most cytoplasmic and nuclear Fe/S proteins, while the CIAO1:CIAO2A complex contributes to ACO1 maturation and IREB2 stabilization. CIAO1 Protein, Human is the recombinant human-derived CIAO1 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Biological Activity
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CIAO1 protein is a key player in the cytosolic iron-sulfur protein assembly (CIA) complex, interacting with CIAO2A or CIAO2B and MMS19 to affect different iron-sulfur protein assembly pathways. The CIAO1:CIAO2B:MMS19 assembly facilitates most cytoplasmic and nuclear Fe/S proteins, while the CIAO1:CIAO2A complex contributes to ACO1 maturation and IREB2 stabilization. CIAO1 Protein, Human is the recombinant human-derived CIAO1 protein, expressed by E. coli , with tag free.

Background

CIAO1 emerges as a pivotal player in the cytosolic iron-sulfur protein assembly (CIA) complex, a multiprotein entity orchestrating the integration of iron-sulfur clusters into extramitochondrial Fe/S proteins. Its dynamic role within this complex involves specific interactions with CIAO2A or CIAO2B and MMS19, influencing distinct branches of iron-sulfur protein assembly depending on its binding partners. The CIAO1:CIAO2B:MMS19 assembly is particularly involved in facilitating the assembly of most cytosolic-nuclear Fe/S proteins, while the CIAO1:CIAO2A complex specifically contributes to the maturation of ACO1 and stabilization of IREB2. Beyond its involvement in iron-sulfur biogenesis, CIAO1 extends its influence to modulating the transactivation activity of WT1 and participating in chromosome segregation through its association with the mitotic spindle-associated MMXD complex. As an integral component of the CIA complex and various interacting networks, CIAO1 stands as a versatile orchestrator in cellular processes involving iron-sulfur clusters and beyond.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CIAO1 (M1-L339)
      Accession # O76071
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    CIAO1; WD Repeat Domain 39; Prev. WDR39; Cytosolic Iron-Sulfur Protein Assembly 1 Homolog; CIA1; Cytosolic Iron-Sulfur Protein Assembly 1; Probable Cytosolic Iron-Sulfur Protein Assembly Protein CIAO1; WD40 Protein Ciao1; WD Repeat-Containing Protein 39;

  • AA Sequence

    MKDSLVLLGRVPAHPDSRCWFLAWNPAGTLLASCGGDRRIRIWGTEGDSWICKSVLSEGHQRTVRKVAWSPCGNYLASASFDATTCIWKKNQDDFECVTTLEGHENEVKSVAWAPSGNLLATCSRDKSVWVWEVDEEDEYECVSVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCCATLEGHESTVWSLAFDPSGQRLASCSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICTLSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTAHLHQAHSQDVNCVAWNPKEPGLLASCSDDGEVAFWKYQRPEGL

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00