CIAO1 Protein, Human
CIAO1 protein is a key player in the cytosolic iron-sulfur protein assembly (CIA) complex, interacting with CIAO2A or CIAO2B and MMS19 to affect different iron-sulfur protein assembly pathways. The CIAO1:CIAO2B:MMS19 assembly facilitates most cytoplasmic and nuclear Fe/S proteins, while the CIAO1:CIAO2A complex contributes to ACO1 maturation and IREB2 stabilization. CIAO1 Protein, Human is the recombinant human-derived CIAO1 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
CIAO1 protein is a key player in the cytosolic iron-sulfur protein assembly (CIA) complex, interacting with CIAO2A or CIAO2B and MMS19 to affect different iron-sulfur protein assembly pathways. The CIAO1:CIAO2B:MMS19 assembly facilitates most cytoplasmic and nuclear Fe/S proteins, while the CIAO1:CIAO2A complex contributes to ACO1 maturation and IREB2 stabilization. CIAO1 Protein, Human is the recombinant human-derived CIAO1 protein, expressed by E. coli , with tag free.
Background
CIAO1 emerges as a pivotal player in the cytosolic iron-sulfur protein assembly (CIA) complex, a multiprotein entity orchestrating the integration of iron-sulfur clusters into extramitochondrial Fe/S proteins. Its dynamic role within this complex involves specific interactions with CIAO2A or CIAO2B and MMS19, influencing distinct branches of iron-sulfur protein assembly depending on its binding partners. The CIAO1:CIAO2B:MMS19 assembly is particularly involved in facilitating the assembly of most cytosolic-nuclear Fe/S proteins, while the CIAO1:CIAO2A complex specifically contributes to the maturation of ACO1 and stabilization of IREB2. Beyond its involvement in iron-sulfur biogenesis, CIAO1 extends its influence to modulating the transactivation activity of WT1 and participating in chromosome segregation through its association with the mitotic spindle-associated MMXD complex. As an integral component of the CIA complex and various interacting networks, CIAO1 stands as a versatile orchestrator in cellular processes involving iron-sulfur clusters and beyond.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
O76071 (M1-L339)
-
Gene ID9391
-
Molecular Construction
-
N-term
-
CIAO1 (M1-L339)
Accession # O76071 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
CIAO1; WD Repeat Domain 39; Prev. WDR39; Cytosolic Iron-Sulfur Protein Assembly 1 Homolog; CIA1; Cytosolic Iron-Sulfur Protein Assembly 1; Probable Cytosolic Iron-Sulfur Protein Assembly Protein CIAO1; WD40 Protein Ciao1; WD Repeat-Containing Protein 39;
-
AA Sequence
MKDSLVLLGRVPAHPDSRCWFLAWNPAGTLLASCGGDRRIRIWGTEGDSWICKSVLSEGHQRTVRKVAWSPCGNYLASASFDATTCIWKKNQDDFECVTTLEGHENEVKSVAWAPSGNLLATCSRDKSVWVWEVDEEDEYECVSVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCCATLEGHESTVWSLAFDPSGQRLASCSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICTLSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTAHLHQAHSQDVNCVAWNPKEPGLLASCSDDGEVAFWKYQRPEGL
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)