1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. CKMT1A Protein, Human (sf9, His)

CKMT1A is a creatine kinase isoenzyme that plays a key role in the reversible transfer of phosphate between ATP and creatine phosphate. The function of this enzyme is critical for tissues with dynamic energy needs, such as skeletal muscle, heart, brain, and sperm. CKMT1A Protein, Human (sf9, His) is the recombinant human-derived CKMT1A protein, expressed by Sf9 insect cells , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CKMT1A is a creatine kinase isoenzyme that plays a key role in the reversible transfer of phosphate between ATP and creatine phosphate. The function of this enzyme is critical for tissues with dynamic energy needs, such as skeletal muscle, heart, brain, and sperm. CKMT1A Protein, Human (sf9, His) is the recombinant human-derived CKMT1A protein, expressed by Sf9 insect cells , with N-His labeled tag.

Background

The CKMT1A protein, a creatine kinase isoenzyme, is instrumental in reversibly catalyzing the transfer of phosphate between ATP and various phosphogens, notably creatine phosphate. This enzymatic activity holds significant importance in tissues with substantial and fluctuating energy demands, including skeletal muscle, heart, brain, and spermatozoa. Creatine kinase isoenzymes, including CKMT1A, play a central role in energy transduction, facilitating the efficient utilization and storage of energy in response to dynamic metabolic requirements in these tissues.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

Sf9 insect cells

Tag

N-His

Accession

P12532 (A40-H417)

Gene ID
Molecular Construction
N-term
His
CKMT1A (A40-H417)
Accession # P12532
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Creatine kinase U-type, mitochondrial; Mia-CK; U-MtCK; CKMT; CKMT1B
AA Sequence

ASERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH

Molecular Weight

Approximately 43 kDa.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 8.5, 10% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

CKMT1A Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CKMT1A Protein, Human (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CKMT1A Protein, Human (sf9, His)
Cat. No.:
HY-P76264
Quantity:
MCE Japan Authorized Agent: