CKS2 Protein, Human
CKS2 protein intricately binds to TEK/TIE2 to regulate ANGPT1 signaling. Its binding induces receptor tyrosine phosphorylation, affecting downstream cellular responses. CKS2 Protein, Human is the recombinant human-derived CKS2 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Stockage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Activité biologique
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Activité biologique
Description
CKS2 protein intricately binds to TEK/TIE2 to regulate ANGPT1 signaling. Its binding induces receptor tyrosine phosphorylation, affecting downstream cellular responses. CKS2 Protein, Human is the recombinant human-derived CKS2 protein, expressed by E. coli , with tag free.
Background
Angiopoietin-4 (ANGPT4) intricately engages with TEK/TIE2, exerting regulatory control over ANGPT1 signaling. Its binding to TEK/TIE2 has the potential to induce tyrosine phosphorylation of the receptor, thereby influencing downstream cellular responses. ANGPT4 plays a crucial role in fostering endothelial cell survival, enhancing cell migration, and promoting angiogenesis, contributing to the intricate orchestration of vascular processes. Structurally, ANGPT4 exists as a homodimer, with disulfide linkages ensuring molecular stability. The direct interaction with TEK/TIE2 underscores the significance of ANGPT4 in modulating key signaling pathways associated with vascular homeostasis and angiogenic responses.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P33552 (M1-K79)
-
Gene ID1164
-
Molecular Construction
-
N-term
-
CKS2 (M1-K79)
Accession # P33552 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
CKS2; CKS-2; CDC28 Protein Kinase Regulatory Subunit 2; CKS1(S. Cerevisiae Cdc28/Cdc2 Kinase Subunit) Homolog-2; Cyclin-Dependent Kinases Regulatory Subunit 2; CKSHS2; CDC28 Protein Kinase 2
-
AA Sequence
MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK
-
Pureté
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
