1. Recombinant Proteins
  2. Enzymes & Regulators
  3. CKS2 Protein, Human

CKS2 protein intricately binds to TEK/TIE2 to regulate ANGPT1 signaling. Its binding induces receptor tyrosine phosphorylation, affecting downstream cellular responses. CKS2 Protein, Human is the recombinant human-derived CKS2 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CKS2 protein intricately binds to TEK/TIE2 to regulate ANGPT1 signaling. Its binding induces receptor tyrosine phosphorylation, affecting downstream cellular responses. CKS2 Protein, Human is the recombinant human-derived CKS2 protein, expressed by E. coli , with tag free.

Background

Angiopoietin-4 (ANGPT4) intricately engages with TEK/TIE2, exerting regulatory control over ANGPT1 signaling. Its binding to TEK/TIE2 has the potential to induce tyrosine phosphorylation of the receptor, thereby influencing downstream cellular responses. ANGPT4 plays a crucial role in fostering endothelial cell survival, enhancing cell migration, and promoting angiogenesis, contributing to the intricate orchestration of vascular processes. Structurally, ANGPT4 exists as a homodimer, with disulfide linkages ensuring molecular stability. The direct interaction with TEK/TIE2 underscores the significance of ANGPT4 in modulating key signaling pathways associated with vascular homeostasis and angiogenic responses.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P33552 (M1-K79)

Gene ID

1164

Molecular Construction
N-term
CKS2 (M1-K79)
Accession # P33552
C-term
Protein Length

Full Length

Synonyms
CKS2; Cyclin-dependent kinases regulatory subunit 2; CKS-2
AA Sequence

MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CKS2 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CKS2 Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CKS2 Protein, Human
Cat. No.:
HY-P701662
Quantity:
MCE Japan Authorized Agent: