Copy Link Print Information

CKS2 Protein, Human

CKS2 protein intricately binds to TEK/TIE2 to regulate ANGPT1 signaling. Its binding induces receptor tyrosine phosphorylation, affecting downstream cellular responses. CKS2 Protein, Human is the recombinant human-derived CKS2 protein, expressed by E. coli , with tag free.

Para uso exclusivo en investigación. No vendemos a pacientes.
  • Species: Human
  • Source: E. coli
  • CKS2 Protein, Human Product Image
Tamaño
Precio
Stock
Cantidad
Amount: USD 0.00
Please select quantity
or
or

* Seleccione Cantidad antes de agregar artículos.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Encuentre su distribuidor local Your local distributor: Hycultec GmbHHycultec
  • Actividad biológica
  • Product Properties
  • Documentación
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Actividad biológica

Descripciòn

CKS2 protein intricately binds to TEK/TIE2 to regulate ANGPT1 signaling. Its binding induces receptor tyrosine phosphorylation, affecting downstream cellular responses. CKS2 Protein, Human is the recombinant human-derived CKS2 protein, expressed by E. coli , with tag free.

Background

Angiopoietin-4 (ANGPT4) intricately engages with TEK/TIE2, exerting regulatory control over ANGPT1 signaling. Its binding to TEK/TIE2 has the potential to induce tyrosine phosphorylation of the receptor, thereby influencing downstream cellular responses. ANGPT4 plays a crucial role in fostering endothelial cell survival, enhancing cell migration, and promoting angiogenesis, contributing to the intricate orchestration of vascular processes. Structurally, ANGPT4 exists as a homodimer, with disulfide linkages ensuring molecular stability. The direct interaction with TEK/TIE2 underscores the significance of ANGPT4 in modulating key signaling pathways associated with vascular homeostasis and angiogenic responses.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P33552 (M1-K79)

  • Gene ID
    1164
  • Molecular Construction
    • N-term
    • CKS2 (M1-K79)
      Accession # P33552
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    CKS2; Cyclin-dependent kinases regulatory subunit 2; CKS-2

  • AA Sequence

    MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK

  • Pureza

    ≥ 90%, as determined by reducing SDS-PAGE.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Calculadora de dilución

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Obtener un presupuesto En stock

Other size
Obtener un presupuesto
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • CKS2 Protein, Human Product Image
    1/16
  • CKS2 Protein, Human Product Image