Claudin-3/CLDN3 Protein, Human (His-B2M)
Based on 1 Customer Validation
Claudin-3/CLDN3 proteins play a critical role in tight junctions, eliminating intercellular spaces through calcium-independent cell adhesion activity. It exhibits multifunctionality by forming homo- and heteropolymers with other CLDN members, including CLDN1 and CLDN2. Claudin-3/CLDN3 Protein, Human (His-B2M) is the recombinant human-derived Claudin-3/CLDN3 protein, expressed by E. coli , with N-6*His, B2M labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Claudin-3/CLDN3 proteins play a critical role in tight junctions, eliminating intercellular spaces through calcium-independent cell adhesion activity. It exhibits multifunctionality by forming homo- and heteropolymers with other CLDN members, including CLDN1 and CLDN2. Claudin-3/CLDN3 Protein, Human (His-B2M) is the recombinant human-derived Claudin-3/CLDN3 protein, expressed by E. coli , with N-6*His, B2M labeled tag.
Background
Claudin-3/CLDN3 Protein assumes a crucial role in the specific obliteration of the intercellular space within tight junctions, employing calcium-independent cell-adhesion activity. This protein demonstrates its versatility by forming both homo- and heteropolymers with other CLDN members, including interactions with CLDN1 and CLDN2 homopolymers. Additionally, Claudin-3/CLDN3 directly engages with tight junction-associated proteins TJP1/ZO-1, TJP2/ZO-2, and TJP3/ZO-3, emphasizing its integral role in the assembly and maintenance of tight junction complexes. The ability to form polymers and interact with key junctional components highlights Claudin-3/CLDN3's significance in regulating cell adhesion and the structural integrity of intercellular spaces.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His;N-B2M
-
Accession
O15551 (R30-R80)
-
Molecular Construction
-
N-term
-
6*His-B2M
-
CLDN3 (R30-R80)
Accession # O15551 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CLDN3; CPE-R2; Prev. C7orf1; Ventral Prostate.1-Like Protein; Prev. CPETR2; CPE-R 2; HRVP1; Rat Ventral Prostate.1 Protein Homolog; Clostridium Perfringens Enterotoxin Receptor 2; Ventral Prostate.1 Protein Homolog; CPE-Receptor 2; Claudin; Claudin-3; Cla
-
AA Sequence
RVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAAR
-
Predicted Molecular Mass
19.7 kDa
-
Molecular Weight
Approximately 21 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
