Claudin-3/CLDN3 Protein, Human (His-B2M)

Claudin-3/CLDN3 proteins play a critical role in tight junctions, eliminating intercellular spaces through calcium-independent cell adhesion activity. It exhibits multifunctionality by forming homo- and heteropolymers with other CLDN members, including CLDN1 and CLDN2. Claudin-3/CLDN3 Protein, Human (His-B2M) is the recombinant human-derived Claudin-3/CLDN3 protein, expressed by E. coli , with N-6*His, B2M labeled tag.

Claudin-3/CLDN3 Protein assumes a crucial role in the specific obliteration of the intercellular space within tight junctions, employing calcium-independent cell-adhesion activity. This protein demonstrates its versatility by forming both homo- and heteropolymers with other CLDN members, including interactions with CLDN1 and CLDN2 homopolymers. Additionally, Claudin-3/CLDN3 directly engages with tight junction-associated proteins TJP1/ZO-1, TJP2/ZO-2, and TJP3/ZO-3, emphasizing its integral role in the assembly and maintenance of tight junction complexes. The ability to form polymers and interact with key junctional components highlights Claudin-3/CLDN3's significance in regulating cell adhesion and the structural integrity of intercellular spaces.

Human

E. coli

N-6*His;N-B2M

O15551 (R30-R80)

1365  [NCBI]

Extracellular Domain

RVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAAR

Predict MW: 20.2 kDa; Approximately 21 kDa, reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.