CLEC17A Protein, Human (HEK293, hFc)

CLEC17A Protein, a cell surface receptor, engages in carbohydrate-mediated intercellular communication in the germinal center. It shows affinity for glycans with alpha-linked mannose or fucose residues. As an oligomer formed through disulfide linkages, CLEC17A is crucial for complex molecular interactions, contributing to essential cellular processes within the germinal center. CLEC17A Protein, Human (CHO, hFc) is the recombinant human-derived CLEC17A protein, expressed by CHO , with N-hFc labeled tag.

CLEC17A, a cell surface receptor, is potentially engaged in carbohydrate-mediated intercellular communication within the germinal center. This receptor exhibits an affinity for glycans presenting terminal alpha-linked mannose or fucose residues. CLEC17A functions as an oligomer, formed through disulfide linkages, suggesting its involvement in complex molecular interactions essential for cellular processes within the germinal center.

Human

HEK293

N-hFc

Q6ZS10-1 (K194-C378)

388512  [NCBI]

Extracellular Domain

KYQELMEELRMLSFQQMTWRTNMTGMAGLAGLKHDIARVRADTNQSLVELWGLLDCRRITCPEGWLPFEGKCYYFSPSTKSWDEARMFCQENYSHLVIINSFAEHNFVAKAHGSPRVYWLGLNDRAQEGDWRWLDGSPVTLSFWEPEEPNNIHDEDCATMNKGGTWNDLSCYKTTYWICERKCSC

Approximately 60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.;≥ 90%, as determined by HPLC.

<1 EU/μg, determined by LAL method.