CLEC17A Protein, Human (HEK293, hFc)
CLEC17A Protein, a cell surface receptor, engages in carbohydrate-mediated intercellular communication in the germinal center. It shows affinity for glycans with alpha-linked mannose or fucose residues. As an oligomer formed through disulfide linkages, CLEC17A is crucial for complex molecular interactions, contributing to essential cellular processes within the germinal center. CLEC17A Protein, Human (CHO, hFc) is the recombinant human-derived CLEC17A protein, expressed by CHO , with N-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CLEC17A Protein, a cell surface receptor, engages in carbohydrate-mediated intercellular communication in the germinal center. It shows affinity for glycans with alpha-linked mannose or fucose residues. As an oligomer formed through disulfide linkages, CLEC17A is crucial for complex molecular interactions, contributing to essential cellular processes within the germinal center. CLEC17A Protein, Human (CHO, hFc) is the recombinant human-derived CLEC17A protein, expressed by CHO , with N-hFc labeled tag.
Background
CLEC17A, a cell surface receptor, is potentially engaged in carbohydrate-mediated intercellular communication within the germinal center. This receptor exhibits an affinity for glycans presenting terminal alpha-linked mannose or fucose residues. CLEC17A functions as an oligomer, formed through disulfide linkages, suggesting its involvement in complex molecular interactions essential for cellular processes within the germinal center.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-hFc
-
Accession
Q6ZS10-1 (K194-C378)
-
Gene ID388512 [NCBI]
-
Molecular Construction
-
N-term
-
hFc
-
CLEC17A (K194-C378)
Accession # Q6ZS10-1 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CLEC17A; Prolectin; C-Type Lectin Domain Containing 17A; C-Type Lectin Domain Family 17 Member A; C-Type Lectin Domain Family 17, Member A; FLJ45910
-
AA Sequence
KYQELMEELRMLSFQQMTWRTNMTGMAGLAGLKHDIARVRADTNQSLVELWGLLDCRRITCPEGWLPFEGKCYYFSPSTKSWDEARMFCQENYSHLVIINSFAEHNFVAKAHGSPRVYWLGLNDRAQEGDWRWLDGSPVTLSFWEPEEPNNIHDEDCATMNKGGTWNDLSCYKTTYWICERKCSC
-
Predicted Molecular Mass
50.1 kDa
-
Molecular Weight
Approximately 60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.;≥ 90%, as determined by HPLC.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 500 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)