Clec2f Protein, Mouse (HEK293, Fc)
Clec2f Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Clec2f protein, expressed by HEK293, with C-hFc tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Clec2f Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Clec2f protein, expressed by HEK293, with C-hFc tag.
Background
Clec2f is a lectin-type cell surface receptor belonging to the C-type lectin family, primarily involved in immune recognition and signal transduction processes. by similar functions include binding to specific carbohydrate structures, potentially playing roles in pathogen recognition or cell-cell interactions.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
Q8VI21-1 (T63-C196)
-
Gene ID/
-
Molecular Construction
-
N-term
-
Clec2f (T63-C196)
Accession # Q8VI21-1 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
Clrc; Clec2f; C-type lectin-related protein C (Clr-c); C-type lectin domain family 2 member F
-
AA Sequence
TKTEQILINKTYAACPKNWIGVGNKCFYFSEYTSNWTFAQTFCMAQEAQLARFDNEKELNFLKRHMNSSHWIGLHRDSSEHPWRWTDNTEYNNTFLIQGDGECGFLSDNGISSSRDYIPRKWICSRSSNYMLQC
-
Predicted Molecular Mass
42.2 kDa
-
Molecular Weight
Approximately 53-63 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
