CLEC4B2 Protein, Rat (HEK293, His)
Based on 1 Customer Validation
CLEC4B2 Protein, Rat (HEK293, His) is the recombinant rat-derived CLEC4B2 protein, expressed by HEK293, with N-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CLEC4B2 Protein, Rat (HEK293, His) is the recombinant rat-derived CLEC4B2 protein, expressed by HEK293, with N-His labeled tag.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag N-6*His
-
Accession
Q67DU9 (M44-L208)
-
Molecular Construction
-
N-term
-
His
-
CLEC4B2 (M44-L208)
Accession # Q67DU9 -
C-term
-
-
Protein Length
Partial
-
Synonyms
Aplra1; Clec4b2; Antigen presenting cell lectin-like receptor A1
-
AA Sequence
MMEKPNRRLSELHTYNSNFTCCSDGTMVSGKVWSCCPKDWKPFGSHCYFTTDFVANWNESKEKCSHMGAHLLVIHSQEEQDFINGILDTRWGYFTGLSDQGQNQWQWIDQTPYNESVTFWHEDEPNNDYEKCVEINHHKDIGWGWNDVVCSSEHKSICQVKKIYL
-
Molecular Weight
Approximately 31-36 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (233 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)