CNDP1 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
The CNDP1 protein is critical in cellular processes and catalyzes the hydrolysis of the Xaa-His dipeptide, with the highest activity against carnosine and anserine. This enzyme specificity highlights the critical role of CNDP1 in regulating the breakdown of specific dipeptides, especially those involving histidine. CNDP1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CNDP1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The CNDP1 protein is critical in cellular processes and catalyzes the hydrolysis of the Xaa-His dipeptide, with the highest activity against carnosine and anserine. This enzyme specificity highlights the critical role of CNDP1 in regulating the breakdown of specific dipeptides, especially those involving histidine. CNDP1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CNDP1 protein, expressed by HEK293 , with C-His labeled tag.
Background
The CNDP1 protein plays a crucial role in cellular processes by catalyzing the hydrolysis of peptide bonds in Xaa-His dipeptides, exhibiting the highest enzymatic activity towards substrates such as carnosine (beta-alanyl-L-histidine) and anserine (beta-alanyl-3-methyl-histidine). Through its peptide bond hydrolysis activity, CNDP1 contributes to the cleavage of dipeptides, particularly those involving histidine, and is particularly efficient in processing carnosine and anserine. This enzymatic specificity underscores the significance of CNDP1 in regulating the breakdown of specific dipeptides and suggests its potential role in modulating cellular levels of bioactive peptides derived from such hydrolytic reactions.
Verified Bioactivity
Measured by its ability to cleave 2mM carnosine (beta-Ala-L-His) in a two-step assay for 30 min at 25°C. The specific activity is 3557.59 pmol/min/μg.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-10*His
-
Accession
Q8BUG2 (M1-Y492)
-
Molecular Construction
-
N-term
-
CNDP1 (M1-Y492)
Accession # Q8BUG2 -
His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
CNDP1; HsT2308; Carnosine Dipeptidase 1; Carnosine Dipeptidase 1 (Metallopeptidase M20 Family); CPGL2; CNDP Dipeptidase 1; CN1; Serum Carnosinase; Glutamate Carboxypeptidase-Like Protein 2; Carnosinase 1; Beta-Ala-His Dipeptidase; MGC10825
-
AA Sequence
MFSSAHSGLLEKLFHYIDLHQDEFVQTLKEWVAIESDSVQPVPRLRQKLFQMMALAADKLRNLGAGVESIDLGSQQMPDGQSLPIPPILLAELGSDPEKPTVCFYGHLDVQPAQKDDGWLTDPYTLTEVDGKLYGRGATDNKGPVLAWINAVSTFRALQQDLPVNIKFILEGMEEAGSIALEELVMREKDHFFSSVDYIVISDNLWLSQRKPALTYGTRGNCYFTVEVKCRDQDFHSGTFGGILNEPMADLVALLGSLVDSSGHILIPGIYDQMAPITEGEKTMYKNIDMDLEEYQNINQVEKFLFDTKEELLMHLWRYPSLSIHGIEGAFDEPGTKTVIPGRVLGKFSIRLVPTMSPSVVEKQVTQHLEAVFSKRNSFNKMAVSMVLGLHPWTANVNDTQYLAAQRTIKTVFGVNPDMIRDGSTIPIAKIFQAITQKSVMMLPLGAVDDGEHSQNEKINRWNYIQGSKLFAAFFLELSKQHSGHQMPSSVY
-
Molecular Weight
Approximately 55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose and 5% mannitol.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
