CNDP1 Protein, Mouse (HEK293, His)

The CNDP1 protein is critical in cellular processes and catalyzes the hydrolysis of the Xaa-His dipeptide, with the highest activity against carnosine and anserine. This enzyme specificity highlights the critical role of CNDP1 in regulating the breakdown of specific dipeptides, especially those involving histidine. CNDP1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CNDP1 protein, expressed by HEK293 , with C-His labeled tag. The total length of CNDP1 Protein, Mouse (HEK293, His) is 492 a.a., with molecular weight of ~57 KDa.

The CNDP1 protein plays a crucial role in cellular processes by catalyzing the hydrolysis of peptide bonds in Xaa-His dipeptides, exhibiting the highest enzymatic activity towards substrates such as carnosine (beta-alanyl-L-histidine) and anserine (beta-alanyl-3-methyl-histidine). Through its peptide bond hydrolysis activity, CNDP1 contributes to the cleavage of dipeptides, particularly those involving histidine, and is particularly efficient in processing carnosine and anserine. This enzymatic specificity underscores the significance of CNDP1 in regulating the breakdown of specific dipeptides and suggests its potential role in modulating cellular levels of bioactive peptides derived from such hydrolytic reactions.

Measured by its ability to cleave 2mM carnosine (beta-Ala-L-His) in a two-step assay for 30 min at 25°C. The specific activity is 3557.59 pmol/min/μg.

Mouse

HEK293

C-10*His

Q8BUG2 (M1-Y492)

338403  [NCBI]

MFSSAHSGLLEKLFHYIDLHQDEFVQTLKEWVAIESDSVQPVPRLRQKLFQMMALAADKLRNLGAGVESIDLGSQQMPDGQSLPIPPILLAELGSDPEKPTVCFYGHLDVQPAQKDDGWLTDPYTLTEVDGKLYGRGATDNKGPVLAWINAVSTFRALQQDLPVNIKFILEGMEEAGSIALEELVMREKDHFFSSVDYIVISDNLWLSQRKPALTYGTRGNCYFTVEVKCRDQDFHSGTFGGILNEPMADLVALLGSLVDSSGHILIPGIYDQMAPITEGEKTMYKNIDMDLEEYQNINQVEKFLFDTKEELLMHLWRYPSLSIHGIEGAFDEPGTKTVIPGRVLGKFSIRLVPTMSPSVVEKQVTQHLEAVFSKRNSFNKMAVSMVLGLHPWTANVNDTQYLAAQRTIKTVFGVNPDMIRDGSTIPIAKIFQAITQKSVMMLPLGAVDDGEHSQNEKINRWNYIQGSKLFAAFFLELSKQHSGHQMPSSVY

Approximately 57 kDa.

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 5% trehalose and 5% mannitol.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.