Endotrophin Protein, Human (HEK293)
COL6A3 protein is an important component of type VI collagen and has the function of a cell-binding protein. Collagen VI trimers are composed of three distinct chains: alpha-1(VI), alpha-2(VI), and alpha-3(VI), alpha-5(VI), or alpha-6(VI). Endotrophin, Human (HEK293) is the recombinant human-derived Endotrophin protein, expressed by HEK293, with N-10*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
COL6A3 protein is an important component of type VI collagen and has the function of a cell-binding protein. Collagen VI trimers are composed of three distinct chains: alpha-1(VI), alpha-2(VI), and alpha-3(VI), alpha-5(VI), or alpha-6(VI). Endotrophin, Human (HEK293) is the recombinant human-derived Endotrophin protein, expressed by HEK293, with N-10*His labeled tag.
Background
The COL6A3 protein, part of the collagen VI family, functions as a cell-binding protein. Its structure comprises trimers consisting of three distinct chains: alpha-1(VI), alpha-2(VI), and either alpha-3(VI), alpha-5(VI), or alpha-6(VI). This trimeric composition reflects the diverse nature of collagen VI, allowing for variations in the alpha chains. Notably, collagen VI serves as an essential mediator in cell adhesion processes. The trimeric arrangement, with its distinct alpha chain combinations, underscores the versatility and adaptability of COL6A3 in facilitating cell interactions and highlights its significance in various physiological contexts. (
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
P12111-1 (T3101-T3177)
-
Molecular Construction
-
N-term
-
Endotrophin (T3101-T3177)
Accession # P12111-1 -
C-term
-
-
Protein Length
C5 domain of the COL6A3 chain
-
Synonyms
COL6A3; COL6A3 Protein; Collagen Type VI Alpha 3 Chain; BTHLM1C; Collagen Alpha-3(VI) Chain; BTHLM1; Collagen, Type VI, Alpha 3; UCMD1C; Epididymis Secretory Sperm Binding Protein; DYT27; Collagen VI, Alpha-3 Polypeptide; UCMD1
-
AA Sequence
TEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPVLAKPGVISVMGT
-
Predicted Molecular Mass
8.5 kDa
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)