COL6A3 Protein, Human (HEK293)

COL6A3 protein is an important component of type VI collagen and has the function of a cell-binding protein. Collagen VI trimers are composed of three distinct chains: alpha-1(VI), alpha-2(VI), and alpha-3(VI), alpha-5(VI), or alpha-6(VI). COL6A3 Protein, Human (HEK293) is the recombinant human-derived COL6A3 protein, expressed by HEK293 , with tag free.

The COL6A3 protein, part of the collagen VI family, functions as a cell-binding protein. Its structure comprises trimers consisting of three distinct chains: alpha-1(VI), alpha-2(VI), and either alpha-3(VI), alpha-5(VI), or alpha-6(VI). This trimeric composition reflects the diverse nature of collagen VI, allowing for variations in the alpha chains. Notably, collagen VI serves as an essential mediator in cell adhesion processes. The trimeric arrangement, with its distinct alpha chain combinations, underscores the versatility and adaptability of COL6A3 in facilitating cell interactions and highlights its significance in various physiological contexts. (

Human

HEK293

Tag Free

P12111-1 (T3101-T3177)

1293  [NCBI]

Partial

TEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPVLAKPGVISVMGT

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.