Complement Factor D/Adipsin Protein, Rhesus macaque (HEK293, His)
Complement Factor D/Adipsin Protein is a member of the S1, or chymotrypsin, family of serine peptidases. Complement Factor D is expressed by adipose cells, plays an important role in both physiology and pathophysiology, where it plays a regulatory role in the complement system. Complement Factor D cleaves factor B when the latter is complexed with factor C3b, activating the C3bbb complex, which then becomes the C3 convertase of the alternate pathway. Complement Factor D/Adipsin Protein, Rhesus macaque (HEK293, His) is the recombinant Rhesus Macaque-derived Complement Factor D/Adipsin protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rhesus Macaque
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
Complement Factor D/Adipsin Protein is a member of the S1, or chymotrypsin, family of serine peptidases. Complement Factor D is expressed by adipose cells, plays an important role in both physiology and pathophysiology, where it plays a regulatory role in the complement system. Complement Factor D cleaves factor B when the latter is complexed with factor C3b, activating the C3bbb complex, which then becomes the C3 convertase of the alternate pathway. Complement Factor D/Adipsin Protein, Rhesus macaque (HEK293, His) is the recombinant Rhesus Macaque-derived Complement Factor D/Adipsin protein, expressed by HEK293 , with C-His labeled tag.
Background
Complement factor D (CFD), also known as Adipsin, is a member of the S1, or chymotrypsin, family of serine peptidases. CFD is expressed by adipose cells, plays an important role in both physiology and pathophysiology, where it plays a regulatory role in the complement system. The complement system is activated as the first-line of defense against invading pathogens but is also involved in systemic inflammation, thrombosis and even autoimmune diseases. CFD plays a crucial role in the alternate pathway of the complement system by cleaving Factor B when it is complexed with Factor C3b. This cleavage activates the C3bbb complex, transforming it into the C3 convertase of the alternate pathway. In a process homologous to C1s in the classical pathway, CFD orchestrates the activation of the complement cascade, contributing to immune responses and host defense mechanisms. The specificity of its cleavage activity and its involvement in the formation of key complement complexes highlight the pivotal role of CFD in the regulation and amplification of the immune response against pathogens. In addition, CFD regulates collagen type I expression and fibroblast migration to enhance human tendon repair and healing outcomes[1][2].
Technical Parameters
-
Species Rhesus Macaque
-
Source HEK293
-
Tag C-8*His
-
Accession
H9EXC1 (Q21-A253)
-
Molecular Construction
-
N-term
-
CFD (Q21-A253)
Accession # H9EXC1 -
8*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CFD; C3 Convertase Activator; Prev. PFD; D Component Of Complement (Adipsin); Prev. DF; Complement Factor D Preproprotein; Properdin Factor D; Complement Factor D (Adipsin); Adipsin; Complement Factor D; ADN
-
AA Sequence
QPRGRILGGREAEAHARPYMASVQVNGEHLCGGVLVAEQWVLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSRPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVEPGTLCDVAGWGIVSHAGRRPDRLQHVLLPVLDRATCNRRTHHDGAITQRMMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTRVASYAAWIDSVLA
-
Predicted Molecular Mass
25.7 kDa
-
Molecular Weight
Approximately 26-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)