Complement Factor D/Adipsin Protein, Rhesus macaque (HEK293, His)

Complement Factor D/Adipsin Protein is a member of the S1, or chymotrypsin, family of serine peptidases. Complement Factor D is expressed by adipose cells, plays an important role in both physiology and pathophysiology, where it plays a regulatory role in the complement system. Complement Factor D cleaves factor B when the latter is complexed with factor C3b, activating the C3bbb complex, which then becomes the C3 convertase of the alternate pathway. Complement Factor D/Adipsin Protein, Rhesus macaque (HEK293, His) is the recombinant Rhesus Macaque-derived Complement Factor D/Adipsin protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rhesus Macaque
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Complement Factor D/Adipsin Protein is a member of the S1, or chymotrypsin, family of serine peptidases. Complement Factor D is expressed by adipose cells, plays an important role in both physiology and pathophysiology, where it plays a regulatory role in the complement system. Complement Factor D cleaves factor B when the latter is complexed with factor C3b, activating the C3bbb complex, which then becomes the C3 convertase of the alternate pathway. Complement Factor D/Adipsin Protein, Rhesus macaque (HEK293, His) is the recombinant Rhesus Macaque-derived Complement Factor D/Adipsin protein, expressed by HEK293 , with C-His labeled tag.

Background

Complement factor D (CFD), also known as Adipsin, is a member of the S1, or chymotrypsin, family of serine peptidases. CFD is expressed by adipose cells, plays an important role in both physiology and pathophysiology, where it plays a regulatory role in the complement system. The complement system is activated as the first-line of defense against invading pathogens but is also involved in systemic inflammation, thrombosis and even autoimmune diseases. CFD plays a crucial role in the alternate pathway of the complement system by cleaving Factor B when it is complexed with Factor C3b. This cleavage activates the C3bbb complex, transforming it into the C3 convertase of the alternate pathway. In a process homologous to C1s in the classical pathway, CFD orchestrates the activation of the complement cascade, contributing to immune responses and host defense mechanisms. The specificity of its cleavage activity and its involvement in the formation of key complement complexes highlight the pivotal role of CFD in the regulation and amplification of the immune response against pathogens. In addition, CFD regulates collagen type I expression and fibroblast migration to enhance human tendon repair and healing outcomes[1][2].

Technical Parameters

  • Species Rhesus Macaque
  • Source HEK293
  • Tag C-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CFD (Q21-A253)
      Accession # H9EXC1
    • 8*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CFD; C3 Convertase Activator; Prev. PFD; D Component Of Complement (Adipsin); Prev. DF; Complement Factor D Preproprotein; Properdin Factor D; Complement Factor D (Adipsin); Adipsin; Complement Factor D; ADN

  • AA Sequence

    QPRGRILGGREAEAHARPYMASVQVNGEHLCGGVLVAEQWVLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSRPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVEPGTLCDVAGWGIVSHAGRRPDRLQHVLLPVLDRATCNRRTHHDGAITQRMMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTRVASYAAWIDSVLA

  • Predicted Molecular Mass

    25.7 kDa

  • Molecular Weight

    Approximately 26-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00