1. Recombinant Proteins
  2. Complement System
  3. Complement Regulatory Proteins
  4. Factor D
  5. Complement Factor D/Adipsin Protein, Rhesus macaque (HEK293, His)

Complement Factor D/Adipsin Protein, Rhesus macaque (HEK293, His)

Cat. No.: HY-P77898
Handling Instructions Technical Support

Complement Factor D/Adipsin Protein is a member of the S1, or chymotrypsin, family of serine peptidases. Complement Factor D is expressed by adipose cells, plays an important role in both physiology and pathophysiology, where it plays a regulatory role in the complement system. Complement Factor D cleaves factor B when the latter is complexed with factor C3b, activating the C3bbb complex, which then becomes the C3 convertase of the alternate pathway. Complement Factor D/Adipsin Protein, Rhesus macaque (HEK293, His) is the recombinant Rhesus Macaque-derived Complement Factor D/Adipsin protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Complement Factor D/Adipsin Protein is a member of the S1, or chymotrypsin, family of serine peptidases. Complement Factor D is expressed by adipose cells, plays an important role in both physiology and pathophysiology, where it plays a regulatory role in the complement system. Complement Factor D cleaves factor B when the latter is complexed with factor C3b, activating the C3bbb complex, which then becomes the C3 convertase of the alternate pathway. Complement Factor D/Adipsin Protein, Rhesus macaque (HEK293, His) is the recombinant Rhesus Macaque-derived Complement Factor D/Adipsin protein, expressed by HEK293 , with C-His labeled tag.

Background

Complement factor D (CFD), also known as Adipsin, is a member of the S1, or chymotrypsin, family of serine peptidases. CFD is expressed by adipose cells, plays an important role in both physiology and pathophysiology, where it plays a regulatory role in the complement system. The complement system is activated as the first-line of defense against invading pathogens but is also involved in systemic inflammation, thrombosis and even autoimmune diseases. CFD plays a crucial role in the alternate pathway of the complement system by cleaving Factor B when it is complexed with Factor C3b. This cleavage activates the C3bbb complex, transforming it into the C3 convertase of the alternate pathway. In a process homologous to C1s in the classical pathway, CFD orchestrates the activation of the complement cascade, contributing to immune responses and host defense mechanisms. The specificity of its cleavage activity and its involvement in the formation of key complement complexes highlight the pivotal role of CFD in the regulation and amplification of the immune response against pathogens. In addition, CFD regulates collagen type I expression and fibroblast migration to enhance human tendon repair and healing outcomes[1][2].

Species

Rhesus Macaque

Source

HEK293

Tag

C-8*His

Accession

H9EXC1 (Q21-A253)

Gene ID
Molecular Construction
N-term
CFD (Q21-A253)
Accession # H9EXC1
8*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Adipsin; C3 convertase activator; Complement factor D; CFD; PFD; DF; ADN; FACTOR D; AMBP-1; EC 3.4.21; EC 3.4.21.46
AA Sequence

QPRGRILGGREAEAHARPYMASVQVNGEHLCGGVLVAEQWVLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSRPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVEPGTLCDVAGWGIVSHAGRRPDRLQHVLLPVLDRATCNRRTHHDGAITQRMMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTRVASYAAWIDSVLA

Predicted Molecular Mass
25.7 kDa
Molecular Weight

Approximately 26-30 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Complement Factor D/Adipsin Protein, Rhesus macaque (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Complement Factor D/Adipsin Protein, Rhesus macaque (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Complement Factor D/Adipsin Protein, Rhesus macaque (HEK293, His)
Cat. No.:
HY-P77898
Quantity:
MCE Japan Authorized Agent: