1. Recombinant Proteins
  2. Complement System
  3. Complement Regulatory Proteins
  4. Complement Factor P
  5. Complement Factor D/CFP Protein, Human (HEK293, His)

Complement Factor D/CFP Protein, Human (HEK293, His)

Cat. No.: HY-P704214
Handling Instructions Technical Support

Properdin is a key regulator in the alternative pathway of complement activation, enhancing stability by binding to the C3 and C5 convertase complexes. It prevents CFI-CFH-mediated degradation of C3b to form plasma dimers, trimers, or tetramers. Complement Factor D/CFP Protein, Human (HEK293, His) is the recombinant human-derived Complement Factor D/CFP protein, expressed by HEK293, with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
100 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Properdin is a key regulator in the alternative pathway of complement activation, enhancing stability by binding to the C3 and C5 convertase complexes. It prevents CFI-CFH-mediated degradation of C3b to form plasma dimers, trimers, or tetramers. Complement Factor D/CFP Protein, Human (HEK293, His) is the recombinant human-derived Complement Factor D/CFP protein, expressed by HEK293, with C-His labeled tag.

Background

Properdin is a crucial positive regulator within the alternate pathway (AP) of complement activation, playing a pivotal role in enhancing the stability of the C3- and C5-convertase enzyme complexes. By binding to these complexes, Properdin inhibits the CFI-CFH mediated degradation of Complement C3 beta chain (C3b). In its plasma form, Properdin forms dimers, trimers, or tetramers in specific proportions. Notably, Properdin interacts with the pro-C3-convertase enzyme complex (C3b-Bb), consisting of Complement C3 beta chain (C3b) and the Complement factor B Bb fragment (Bb), through its TSP type-1 5 domain. This interaction is pivotal for stabilizing the complex, transforming it into the active C3-convertase enzyme complex (C3b-Bb-FP). Furthermore, Properdin interacts directly with C3b and Complement factor B (CFB), highlighting its multifaceted role in complement activation and regulation.

Species

Human

Source

HEK293

Tag

C-His

Accession

P27918-1 (D28-L469)

Gene ID

5199

Molecular Construction
N-term
CFP (D28-L469)
Accession # P27918-1
His
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
Properdin ; Complement factor P ; CFP ; PFC
AA Sequence

DPVLCFTQYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWSTWAPCSVTCSEGSQLRYRRCVGWNGQCSGKVAPGTLEWQLQACEDQQCCPEMGGWSGWGPWEPCSVTCSKGTRTRRRACNHPAPKCGGHCPGQAQESEACDTQQVCPTHGAWATWGPWTPCSASCHGGPHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCPVAGGWGPWGPVSPCPVTCGLGQTMEQRTCNHPVPQHGGPFCAGDATRTHICNTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTCRGRKFDGHRCAGQQQDIRHCYSIQHCPLKGSWSEWSTWGLCMPPCGPNPTRARQRLCTPLLPKYPPTVSMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEEL

Predicted Molecular Mass
50.7 kDa
Molecular Weight

Approximately 55 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Structure/Form
Monomer
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Complement Factor D/CFP Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Complement Factor D/CFP Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Complement Factor D/CFP Protein, Human (HEK293, His)
Cat. No.:
HY-P704214
Quantity:
MCE Japan Authorized Agent: