Complement Factor D/CFP Protein, Human (HEK293, His)
Properdin is a key regulator in the alternative pathway of complement activation, enhancing stability by binding to the C3 and C5 convertase complexes. It prevents CFI-CFH-mediated degradation of C3b to form plasma dimers, trimers, or tetramers. Complement Factor D/CFP Protein, Human (HEK293, His) is the recombinant human-derived Complement Factor D/CFP protein, expressed by HEK293, with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Properdin is a key regulator in the alternative pathway of complement activation, enhancing stability by binding to the C3 and C5 convertase complexes. It prevents CFI-CFH-mediated degradation of C3b to form plasma dimers, trimers, or tetramers. Complement Factor D/CFP Protein, Human (HEK293, His) is the recombinant human-derived Complement Factor D/CFP protein, expressed by HEK293, with C-His labeled tag.
Background
Properdin is a crucial positive regulator within the alternate pathway (AP) of complement activation, playing a pivotal role in enhancing the stability of the C3- and C5-convertase enzyme complexes. By binding to these complexes, Properdin inhibits the CFI-CFH mediated degradation of Complement C3 beta chain (C3b). In its plasma form, Properdin forms dimers, trimers, or tetramers in specific proportions. Notably, Properdin interacts with the pro-C3-convertase enzyme complex (C3b-Bb), consisting of Complement C3 beta chain (C3b) and the Complement factor B Bb fragment (Bb), through its TSP type-1 5 domain. This interaction is pivotal for stabilizing the complex, transforming it into the active C3-convertase enzyme complex (C3b-Bb-FP). Furthermore, Properdin interacts directly with C3b and Complement factor B (CFB), highlighting its multifaceted role in complement activation and regulation.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P27918-1 (D28-L469)
-
Gene ID5199
-
Molecular Construction
-
N-term
-
CFP (D28-L469)
Accession # P27918-1 -
His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
CFP; Complement Factor Properdin, Isoform CRA_c; Prev. PFC; Alternative Protein CFP; Complement Factor P; PROPERDIN; Properdin P Factor, Complement; BFD; Properdin; PFD; CDNA FLJ16673 Fis, Clone THYMU3003403, Highly Similar To Properdin; Complement Factor
-
AA Sequence
DPVLCFTQYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWSTWAPCSVTCSEGSQLRYRRCVGWNGQCSGKVAPGTLEWQLQACEDQQCCPEMGGWSGWGPWEPCSVTCSKGTRTRRRACNHPAPKCGGHCPGQAQESEACDTQQVCPTHGAWATWGPWTPCSASCHGGPHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCPVAGGWGPWGPVSPCPVTCGLGQTMEQRTCNHPVPQHGGPFCAGDATRTHICNTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTCRGRKFDGHRCAGQQQDIRHCYSIQHCPLKGSWSEWSTWGLCMPPCGPNPTRARQRLCTPLLPKYPPTVSMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEEL
-
Predicted Molecular Mass
50.7 kDa
-
Molecular Weight
Approximately 55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Structure/Form
Monomer
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
