CRIP1 Protein, Human (GST)
Based on 1 Customer Validation
CRIP1 Protein, Human (GST) is the recombinant human-derived CRIP1, expressed by E. coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
CRIP1 Protein, Human (GST) is the recombinant human-derived CRIP1, expressed by E. coli , with N-GST labeled tag.
CRIP1 appears to play a role in zinc absorption and may function as an intracellular zinc transport protein.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
P50238 (M1-K77)
-
Gene ID1396
-
Molecular Construction
-
N-term
-
GST
-
CRIP1 (M1-K77)
Accession # P50238 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
CRIP1; Cysteine-Rich Protein 1; Cysteine Rich Protein 1; CRP-1; CRIP; CRHP; Cysteine-Rich Protein 1 (Intestinal); CRP1; Cysteine-Rich Intestinal Protein; HCRHP; Cysteine-Rich Heart Protein
-
AA Sequence
MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK
-
Predicted Molecular Mass
35.4 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (232 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
