CRISP-1 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
CRISP-1 protein plays a crucial role in promoting the functional maturation of spermatozoa during their transition from the testis to the ductus deferens. Its involvement underscores its significance in the complex regulatory network governing male reproductive physiology, emphasizing its potential impact on sperm functionality and fertility as these cells navigate through the reproductive tract. CRISP-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CRISP-1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CRISP-1 protein plays a crucial role in promoting the functional maturation of spermatozoa during their transition from the testis to the ductus deferens. Its involvement underscores its significance in the complex regulatory network governing male reproductive physiology, emphasizing its potential impact on sperm functionality and fertility as these cells navigate through the reproductive tract. CRISP-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CRISP-1 protein, expressed by HEK293 , with C-His labeled tag.
Background
CRISP-1 protein is implicated in facilitating the functional maturation of spermatozoa during their transit from the testis to the ductus deferens. This suggests a crucial role for CRISP-1 in the intricate processes associated with sperm development and maturation. As these cells navigate through the reproductive tract, CRISP-1 is thought to play a pivotal role in promoting the necessary changes that contribute to the acquisition of functional capabilities by spermatozoa. The involvement of CRISP-1 underscores its significance in the complex regulatory network governing male reproductive physiology, emphasizing its potential impact on sperm functionality and fertility.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
Q03401 (Q20-H244)
-
Molecular Construction
-
N-term
-
CRISP-1 (M1-H244)
Accession # Q03401 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CRISP1; HUMARP; Prev. AEGL1; Acidic Epididymal Glycoprotein-Like 1; CRISP-1; Epididymis Secretory Protein Li 57; ARP; AEG-Like Protein; Cysteine-Rich Secretory Protein 1; Cysteine-Rich Secretory Protein-1 Delta; HSCRISP1D; AEG-Related Protein; HSCRISP1G;
-
AA Sequence
QDSSQENRLEKLSTTKMSVQEEIVSKHNQLRRMVSPSGSDLLKMEWNYDAQVNAQQWADKCTFSHSPIELRTTNLRCGENLFMSSYLASWSSAIQGWYNEYKDLTYDVGPKQPDSVVGHYTQVVWNSTFQVACGVAECPKNPLRYYYVCHYCPVGNYQGRLYTPYTAGEPCASCPDHCEDGLCTNSCGHEDKYTNCKYLKKMLSCEHELLKKGCKATCLCEGKIH
-
Molecular Weight
Approximately 26 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
