CRISP-3 Protein, Human (HEK293, His)
Based on 1 Customer Validation
The CRISP-3 protein interacts with A1BG, indicating a molecular association with potential functional implications. This suggests that CRISP-3 may be involved in processes associated with or regulated by A1BG. The specific nature and significance of this interaction require further elucidation, emphasizing the need for additional investigation into the molecular mechanisms and biological consequences of the CRISP-3 and A1BG interaction. CRISP-3 Protein, Human (HEK293, His) is the recombinant human-derived CRISP-3 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The CRISP-3 protein interacts with A1BG, indicating a molecular association with potential functional implications. This suggests that CRISP-3 may be involved in processes associated with or regulated by A1BG. The specific nature and significance of this interaction require further elucidation, emphasizing the need for additional investigation into the molecular mechanisms and biological consequences of the CRISP-3 and A1BG interaction. CRISP-3 Protein, Human (HEK293, His) is the recombinant human-derived CRISP-3 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
The CRISP-3 protein engages in interaction with A1BG, suggesting a molecular association between CRISP-3 and A1BG. This interaction hints at potential functional implications, with CRISP-3 likely playing a role in processes associated with or regulated by A1BG. The specific nature and significance of this interaction remain to be fully elucidated, underscoring the need for further investigation into the molecular mechanisms and biological consequences of the CRISP-3 and A1BG interaction.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P54108 (N21-Y245)
-
Molecular Construction
-
N-term
-
CRISP-3 (N21-Y245)
Accession # P54108 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CRISP3; CRS3; Cysteine Rich Secretory Protein 3; Aeg2; CRISP-3; Cysteine-Rich Secretory Protein 3; SGP28; Specific Granule Protein Of 28 KDa; DJ442L6.3; Specific Granule Protein (28 KDa)
-
AA Sequence
NEDKDPAFTALLTTQTQVQREIVNKHNELRRAVSPPARNMLKMEWNKEAAANAQKWANQCNYRHSNPKDRMTSLKCGENLYMSSASSSWSQAIQSWFDEYNDFDFGVGPKTPNAVVGHYTQVVWYSSYLVGCGNAYCPNQKVLKYYYVCQYCPAGNWANRLYVPYEQGAPCASCPDNCDDGLCTNGCKYEDLYSNCKSLKLTLTCKHQLVRDSCKASCNCSNSIY
-
Predicted Molecular Mass
26.5 kDa
-
Molecular Weight
Approximately 25-32 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
