CRISP-3 Protein, Human (HEK293, His)

The CRISP-3 protein interacts with A1BG, indicating a molecular association with potential functional implications. This suggests that CRISP-3 may be involved in processes associated with or regulated by A1BG. The specific nature and significance of this interaction require further elucidation, emphasizing the need for additional investigation into the molecular mechanisms and biological consequences of the CRISP-3 and A1BG interaction. CRISP-3 Protein, Human (HEK293, His) is the recombinant human-derived CRISP-3 protein, expressed by HEK293 , with C-6*His labeled tag.

The CRISP-3 protein engages in interaction with A1BG, suggesting a molecular association between CRISP-3 and A1BG. This interaction hints at potential functional implications, with CRISP-3 likely playing a role in processes associated with or regulated by A1BG. The specific nature and significance of this interaction remain to be fully elucidated, underscoring the need for further investigation into the molecular mechanisms and biological consequences of the CRISP-3 and A1BG interaction.

Human

HEK293

C-6*His

P54108 (N21-Y245)

10321  [NCBI]

Full Length of Mature Protein

NEDKDPAFTALLTTQTQVQREIVNKHNELRRAVSPPARNMLKMEWNKEAAANAQKWANQCNYRHSNPKDRMTSLKCGENLYMSSASSSWSQAIQSWFDEYNDFDFGVGPKTPNAVVGHYTQVVWYSSYLVGCGNAYCPNQKVLKYYYVCQYCPAGNWANRLYVPYEQGAPCASCPDNCDDGLCTNGCKYEDLYSNCKSLKLTLTCKHQLVRDSCKASCNCSNSIY

25-32 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.