Copy Link Print Information

CTLA-4 Protein, Human (Biotinylated, HEK293, mFc-Avi)

Customer Review

Based on 1 Customer Validation

The CTLA-4 protein is a key inhibitory receptor and a major negative regulator of T cell responses in coordination of immune regulation. Its unique property is its significantly increased affinity for B7 ligands (CD80/CD86) compared with CD28. CTLA-4 Protein, Human (Biotinylated, HEK293, mFc-Avi) is the recombinant human-derived CTLA-4 protein, expressed by HEK293 , with C-Avi, C-mFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • CTLA-4 Protein, Human (Biotinylated, HEK293, mFc-Avi) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The CTLA-4 protein is a key inhibitory receptor and a major negative regulator of T cell responses in coordination of immune regulation. Its unique property is its significantly increased affinity for B7 ligands (CD80/CD86) compared with CD28. CTLA-4 Protein, Human (Biotinylated, HEK293, mFc-Avi) is the recombinant human-derived CTLA-4 protein, expressed by HEK293 , with C-Avi, C-mFc labeled tag.

Background

GMP CTLA-4, a pivotal inhibitory receptor, emerges as a principal negative regulator orchestrating T-cell responses within the intricate framework of immune modulation. This regulatory function stems from the distinctive property of GMP CTLA-4, displaying significantly heightened affinity for its natural B7 family ligands, CD80 and CD86, compared to the cognate stimulatory coreceptor CD28. This pronounced difference in binding affinity positions GMP CTLA-4 to competitively engage with CD80/B7-1 and CD86/B7.2, exerting a suppressive influence on T-cell activation and finely tuning immune responses. The homodimeric structure of GMP CTLA-4, intricately linked by disulfide bonds, further underscores its role as a molecular sentinel in immune regulation. Additionally, GMP CTLA-4 interacts with ICOSLG, contributing to its multifaceted engagement in immune checkpoint pathways.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Anti-CTLA4 antibody at 1 μg/mL can bind Biotinylated Human CTLA4. The EC 50 is 10.57-15.25 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Avi;C-mFc
  • Accession

    P16410 (A37-F162)

  • Gene ID
    1493
  • Protein Length

    Extracellular Domain

  • Conjugation

    Biotin

  • Synonyms

    CTLA4; Celiac Disease 3; Prev. CELIAC3; Cytotoxic T Lymphocyte Associated Antigen 4 Short Spliced Form; Prev. IDDM12; Cytotoxic T-Lymphocyte-Associated Serine Esterase-4; CTLA-4; Cytotoxic T-Lymphocyte-Associated Protein 4; CD152; Cytotoxic T-Lymphocyte A

  • AA Sequence

    AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDF

  • Predicted Molecular Mass

    42.6 kDa

  • Molecular Weight

    Approximately 50-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • CTLA-4 Protein, Human (Biotinylated, HEK293, mFc-Avi) Product Image
    1/16
  • CTLA-4 Protein, Human (Biotinylated, HEK293, mFc-Avi) Product Image