Cytochrome b5/CYB5A Protein, Human (His)

Cytochrome b5 (CYB5A) is a vital membrane-bound hemoprotein acting as an electron carrier for diverse membrane-bound oxygenases. Positioned in cellular membranes, it crucially facilitates electron transfer processes, supporting the activity of oxygenase enzymes. CYB5A's role as an electron carrier highlights its significance in cellular redox reactions and metabolic pathways involving oxygenases. Cytochrome b5/CYB5A Protein, Human (His) is the recombinant human-derived Cytochrome b5/CYB5A protein, expressed by E. coli , with N-6*His labeled tag.

Cytochrome b5 (CYB5A) is a membrane-bound hemoprotein that serves as an electron carrier for various membrane-bound oxygenases. Positioned within cellular membranes, this protein plays a crucial role in facilitating electron transfer processes, contributing to the activity of oxygenase enzymes. Its function as an electron carrier underscores its significance in cellular redox reactions and metabolic pathways where oxygenases are involved.

Human

E. coli

N-6*His

P00167 (M1-D134)

1528  [NCBI]

Full Length

MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED

Approximately 17 kDa,based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, 0.1 mM EDTA, pH 7.25.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.