Copy Link Print Information

Cytochrome b5/CYB5A Protein, Human (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

Cytochrome b5 (CYB5A) is a vital membrane-bound hemoprotein acting as an electron carrier for diverse membrane-bound oxygenases. Positioned in cellular membranes, it crucially facilitates electron transfer processes, supporting the activity of oxygenase enzymes. CYB5A's role as an electron carrier highlights its significance in cellular redox reactions and metabolic pathways involving oxygenases. Cytochrome b5/CYB5A Protein, Human (His) is the recombinant human-derived Cytochrome b5/CYB5A protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Cytochrome b5/CYB5A Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Cytochrome b5 (CYB5A) is a vital membrane-bound hemoprotein acting as an electron carrier for diverse membrane-bound oxygenases. Positioned in cellular membranes, it crucially facilitates electron transfer processes, supporting the activity of oxygenase enzymes. CYB5A's role as an electron carrier highlights its significance in cellular redox reactions and metabolic pathways involving oxygenases. Cytochrome b5/CYB5A Protein, Human (His) is the recombinant human-derived Cytochrome b5/CYB5A protein, expressed by E. coli , with N-6*His labeled tag.

Background

Cytochrome b5 (CYB5A) is a membrane-bound hemoprotein that serves as an electron carrier for various membrane-bound oxygenases. Positioned within cellular membranes, this protein plays a crucial role in facilitating electron transfer processes, contributing to the activity of oxygenase enzymes. Its function as an electron carrier underscores its significance in cellular redox reactions and metabolic pathways where oxygenases are involved.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession

    P00167 (M1-D134)

  • Gene ID
    1528  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • CYB5A (M1-D134)
      Accession # P00167
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    CYB5A; Microsomal Cytochrome B5 Type A; Prev. CYB5; Microsomal Cytochrome B5; MCB5; Cytochrome B-5; Cytochrome B5; Type 1 Cyt-B5; Cytochrome B5 Type A (Microsomal); METAG; Epididymis Secretory Sperm Binding Protein; Cytochrome B5 Type A; Cytochrome B5 (Mi

  • AA Sequence

    MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED

  • Predicted Molecular Mass

    17.5 kDa

  • Molecular Weight

    Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, 0.1 mM EDTA, pH 7.25.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Cytochrome b5/CYB5A Protein, Human (His) Product Image
    1/16
  • Cytochrome b5/CYB5A Protein, Human (His) Product Image