DCD Protein, Human (P.pastoris, His)

Customer Review

Based on 1 Customer Validation

The DCD protein is found in sweat and has antimicrobial activity against Escherichia coli, Enterococcus faecalis, Staphylococcus aureus, and Candida albicans. DCD Protein, Human (P.pastoris, His) is the recombinant human-derived DCD protein, expressed by P. pastoris , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: P. pastoris
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The DCD protein is found in sweat and has antimicrobial activity against Escherichia coli, Enterococcus faecalis, Staphylococcus aureus, and Candida albicans. DCD Protein, Human (P.pastoris, His) is the recombinant human-derived DCD protein, expressed by P. pastoris , with N-6*His labeled tag.

Background

DCD protein, found in sweat, demonstrates antimicrobial activity during the early stages of bacterial colonization. The secreted peptide forms homohexameric complexes capable of associating with and inserting into pathogen membranes. Upon insertion into bacterial membranes, DCD protein creates anion channels, potentially altering the transmembrane potential crucial for bacterial survival. It exhibits high efficacy against various pathogens, including E. coli, E. faecalis, S. aureus, and C. albicans. Operating optimally under conditions resembling those in sweat, DCD protein also displays proteolytic activity, with a preference for cleaving on the C-terminal side of Arg and, to a lesser extent, Lys residues. Additionally, DCD protein promotes neuron survival and exhibits phosphatase activity, suggesting a multifaceted role in host defense mechanisms. Furthermore, it may have the ability to bind to IgG.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Human
  • Source P. pastoris
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • DCD (Y20-L110)
      Accession # P81605-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    DCD; HCAP; Dermcidin; PIF; AIDD; Diffusible Survival/Evasion Peptide; DSEP; Proteolysis Inducing Factor; Preproteolysin; Survival Promoting Peptide; DCD-1

  • AA Sequence

    YDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL

  • Predicted Molecular Mass

    11.3 kDa

  • Molecular Weight

    Approximately 17 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00