DCD Protein, Human (P.pastoris, His)

The DCD protein is found in sweat and has antimicrobial activity against Escherichia coli, Enterococcus faecalis, Staphylococcus aureus, and Candida albicans. DCD Protein, Human (P.pastoris, His) is the recombinant human-derived DCD protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of DCD Protein, Human (P.pastoris, His) is 91 a.a., with molecular weight (affected by relative charge) of ~ 17 KDa.

DCD protein, found in sweat, demonstrates antimicrobial activity during the early stages of bacterial colonization. The secreted peptide forms homohexameric complexes capable of associating with and inserting into pathogen membranes. Upon insertion into bacterial membranes, DCD protein creates anion channels, potentially altering the transmembrane potential crucial for bacterial survival. It exhibits high efficacy against various pathogens, including E. coli, E. faecalis, S. aureus, and C. albicans. Operating optimally under conditions resembling those in sweat, DCD protein also displays proteolytic activity, with a preference for cleaving on the C-terminal side of Arg and, to a lesser extent, Lys residues. Additionally, DCD protein promotes neuron survival and exhibits phosphatase activity, suggesting a multifaceted role in host defense mechanisms. Furthermore, it may have the ability to bind to IgG.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

P. pastoris

N-6*His

P81605 (Y20-L110)

117159  [NCBI]

YDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL

Approximately 17 kDa. The reducing (R) protein migrat es as 17 kDa in SDS-PAGE may be due to relative charge.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.