DCD Protein, Human (P.pastoris, His)
Based on 1 Customer Validation
The DCD protein is found in sweat and has antimicrobial activity against Escherichia coli, Enterococcus faecalis, Staphylococcus aureus, and Candida albicans. DCD Protein, Human (P.pastoris, His) is the recombinant human-derived DCD protein, expressed by P. pastoris , with N-6*His labeled tag.
- Species: Human
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The DCD protein is found in sweat and has antimicrobial activity against Escherichia coli, Enterococcus faecalis, Staphylococcus aureus, and Candida albicans. DCD Protein, Human (P.pastoris, His) is the recombinant human-derived DCD protein, expressed by P. pastoris , with N-6*His labeled tag.
Background
DCD protein, found in sweat, demonstrates antimicrobial activity during the early stages of bacterial colonization. The secreted peptide forms homohexameric complexes capable of associating with and inserting into pathogen membranes. Upon insertion into bacterial membranes, DCD protein creates anion channels, potentially altering the transmembrane potential crucial for bacterial survival. It exhibits high efficacy against various pathogens, including E. coli, E. faecalis, S. aureus, and C. albicans. Operating optimally under conditions resembling those in sweat, DCD protein also displays proteolytic activity, with a preference for cleaving on the C-terminal side of Arg and, to a lesser extent, Lys residues. Additionally, DCD protein promotes neuron survival and exhibits phosphatase activity, suggesting a multifaceted role in host defense mechanisms. Furthermore, it may have the ability to bind to IgG.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source P. pastoris
-
Tag N-6*His
-
Accession
P81605-1 (Y20-L110)
-
Molecular Construction
-
N-term
-
6*His
-
DCD (Y20-L110)
Accession # P81605-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
DCD; HCAP; Dermcidin; PIF; AIDD; Diffusible Survival/Evasion Peptide; DSEP; Proteolysis Inducing Factor; Preproteolysin; Survival Promoting Peptide; DCD-1
-
AA Sequence
YDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL
-
Predicted Molecular Mass
11.3 kDa
-
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose,
pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)