DDT Protein, Canine (His)
DDT Protein, Canine (His) is the recombinant canine-derived DDT protein, expressed by E. coli, with N-His tag.
- Species: Canine
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
DDT Protein, Canine (His) is the recombinant canine-derived DDT protein, expressed by E. coli, with N-His tag.
Background
DDT is a chemical substance that facilitates the tautomerization of D-dopachrome to 5,6-dihydroxyindole (DHI) with decarboxylation. by similar: This reaction involves the structural rearrangement of D-dopachrome and the removal of a carboxyl group, ultimately yielding DHI.
Technical Parameters
-
Species Canine
-
Source E. coli
-
Tag N-8*His
-
Accession
XP_003639975 (P2-L118)
-
Gene ID100856501
-
Protein Length
Full Length
-
Synonyms
DDT; MIF2; D-Dopachrome Tautomerase; D-DT; D-Dopachrome Decarboxylase; Phenylpyruvate Tautomerase II; MIF-2; DDT1; DDCT
-
AA Sequence
PFVEVDTNLPASRVPAGLEKRLCAATAAILGKPEDRVNVTVRPGLAMAVNGSPEPCAQLLISSIAVVGTAEENRAHSARFFEFLTKELDLGQDRIIIRFFPLEPWQIGKNGTVMTFL
-
Predicted Molecular Mass
13.5 kDa
-
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
