DDT Protein, Human (His)
Based on 1 Customer Validation
DDT Protein, Human (His) is the recombinant human-derived DDT protein, expressed by E. coli, with N-His tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
DDT Protein, Human (His) is the recombinant human-derived DDT protein, expressed by E. coli, with N-His tag.
Background
DDT is a compound involved in the tautomerization of D-dopachrome, which undergoes decarboxylation to produce 5,6-dihydroxyindole (DHI).
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-8*His
-
Accession
P30046 (P2-L118)
-
Gene ID1652
-
Protein Length
Full Length
-
Synonyms
DDT; MIF2; D-Dopachrome Tautomerase; D-DT; D-Dopachrome Decarboxylase; Phenylpyruvate Tautomerase II; MIF-2; DDT1; DDCT
-
AA Sequence
PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
-
Predicted Molecular Mass
13.9 kDa
-
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50mM Tris, 200mM NaCl, 10% Glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (232 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)