DDT Protein, Human (His)

DDT Protein, Human (His) is the recombinant human-derived DDT protein, expressed by E. coli, with N-His tag.

DDT is a compound involved in the tautomerization of D-dopachrome, which undergoes decarboxylation to produce 5,6-dihydroxyindole (DHI).

Human

E. coli

N-8*His

P30046 (P2-L118)

1652

Full Length of Mature Protein

PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL

Approximately 13.9 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by Bis-Tris PAGE.

Solution

Supplied as a 0.22 μm filtered solution of 50mM Tris, 200mM NaCl, 10% Glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.