DDT Protein, Mouse (His)
DDT Protein, Mouse (His) is the recombinant mouse-derived DDT protein, expressed by E. coli, with N-His tag.
- Species: Mouse
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
DDT Protein, Mouse (His) is the recombinant mouse-derived DDT protein, expressed by E. coli, with N-His tag.
DDT is a product formed through the tautomerization of D-dopachrome with decarboxylation to yield 5,6-dihydroxyindole (DHI). by similar: This process represents a key step in pigment synthesis.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-8*His
-
Accession
O35215 (P2-L118)
-
Gene ID13202
-
Protein Length
Full Length of Mature Protein
-
Synonyms
DDT; MIF2; D-Dopachrome Tautomerase; D-DT; D-Dopachrome Decarboxylase; Phenylpyruvate Tautomerase II; MIF-2; DDT1; DDCT
-
AA Sequence
PFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHLLVSSIGVVGTAEQNRTHSASFFKFLTEELSLDQDRIVIRFFPLEAWQIGKKGTVMTFL
-
Predicted Molecular Mass
14.3 kDa
-
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
