Decorin/PGS2 Protein, Bovine (His)
Decorin/PGS2 Protein, Bovine (His) is the recombinant bovine-derived Decorin/PGS2 protein, expressed by E. coli, with N-6*His tag.
- Species: Bovine
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Decorin/PGS2 Protein, Bovine (His) is the recombinant bovine-derived Decorin/PGS2 protein, expressed by E. coli, with N-6*His tag.
Background
Decorin/PGS2 protein influences the rate of fibril formation and exhibits binding affinity towards type I and type II collagen, fibronectin, and TGF-beta. It also forms a ternary complex with MFAP2 and ELN, suggesting its involvement in extracellular matrix organization. Additionally, it interacts with DPT, further highlighting its potential role in modulating matrix assembly and structure.
Technical Parameters
-
Species Bovine
-
Source E. coli
-
Tag N-6*His
-
Accession
P21793 (D31-K360)
-
Gene ID280760
-
Molecular Construction
-
N-term
-
6*His
-
PGS2 (D31-K360)
Accession # P21793 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
DCN; Decorin Proteoglycan; Decorin; Decorin Isoform 3; SLRR1B; Decorin Isoform 4; Bone Proteoglycan II; DKFZp686J19238; DSPG2; PG-S2; PG40; CSCD; Dermatan Sulphate Proteoglycans II; PGII; Small Leucine-Rich Protein 1B; PGS2; Proteoglycan Core Protein
-
AA Sequence
DEASGIGPEEHFPEVPEIEPMGPVCPFRCQCHLRVVQCSDLGLEKVPKDLPPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYLSKNQLKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITTIPQGLPPSLTELHLDGNKITKVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVVYLHNNNISAIGSNDFCPPGYNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRAAVQLGNYK
-
Predicted Molecular Mass
40.5 kDa
-
Structure/Form
Monomer
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
