Copy Link Print Information

DLK-1 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

The DLK-1 protein has been implicated in neuroendocrine differentiation, suggesting a role in the complex processes that control neuroendocrine cell development and specialization. As a monomer, the single molecular form of DLK-1 helps carry out its biological activity. DLK-1 Protein, Human (HEK293, His) is the recombinant human-derived DLK-1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • DLK-1 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The DLK-1 protein has been implicated in neuroendocrine differentiation, suggesting a role in the complex processes that control neuroendocrine cell development and specialization. As a monomer, the single molecular form of DLK-1 helps carry out its biological activity. DLK-1 Protein, Human (HEK293, His) is the recombinant human-derived DLK-1 protein, expressed by HEK293 , with C-His labeled tag.

Background

The DLK-1 protein appears to play a role in neuroendocrine differentiation, suggesting its involvement in the intricate processes associated with the development and specialization of neuroendocrine cells. Structurally, DLK-1 functions as a monomer, indicating that its singular molecular form is instrumental in carrying out its biological activities. Furthermore, DLK-1 interacts with SH3RF2, emphasizing potential molecular associations that may contribute to its functional roles. Further exploration into the specific mechanisms and downstream effects of DLK-1 in neuroendocrine differentiation could provide valuable insights into its significance and potential implications in neural development and cellular differentiation processes.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-8*His
  • Accession

    P80370-1 (A24-Q303)

  • Gene ID
    8788  [NCBI]
  • Molecular Construction
    • N-term
    • DLK-1 (A24-Q303)
      Accession # P80370-1
    • 8*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    DLK1; DLK; Delta Like Non-Canonical Notch Ligand 1; Delta-Like 1 Homolog (Drosophila); PG2; Delta-Like Homolog (Drosophila); Protein Delta Homolog 1; Preadipocyte Factor 1; Pref-1; Delta-Like 1 Homolog; Delta1; Fetal Antigen 1; FA1; Delta-Like 1; ZOG; Sec

  • AA Sequence

    AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNRTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ

  • Predicted Molecular Mass

    30.9 kDa

  • Molecular Weight

    Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • DLK-1 Protein, Human (HEK293, His) Product Image
    1/16
  • DLK-1 Protein, Human (HEK293, His) Product Image