DNAJC9 Protein, Human (His, Strep)

DNAJC9 Protein, Human (His, Strep) is the recombinant human-derived DNAJC9, expressed by E. coli , with Strep, His labeled tag.

DNAJC9 functions as both a histone chaperone and a heat shock co-chaperone. As a histone chaperone, it forms a complex with MCM2 and histone H3-H4 heterodimers, aiding MCM2 in recognizing histone H3-H4 and facilitating histone assembly into nucleosomes. It may also act as a histone co-chaperone alongside TONSL and recruit histone chaperones such as ASF1A, NASP, and SPT2 to histone H3-H4 heterodimers. Additionally, DNAJC9 serves as a co-chaperone for HSP70 family molecular chaperones (e.g., HSPA1A, HSPA1B, and HSPA8), potentially playing a role in recruiting the HSP70 chaperone machinery to histone H3-H4 substrates to maintain histone structural integrity. In vitro, it demonstrates the ability to assemble histones onto DNA.

Human

E. coli

N-His;N-StrepⅡ

Q8WXX5 (G2-K260)

23234

Partial

GLLDLCEEVFGTADLYRVLGVRREASDGEVRRGYHKVSLQVHPDRVGEGDKEDATRRFQILGKVYSVLSDREQRAVYDEQGTVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAFEKTYKGSEEELADIKQAYLDFKGDMDQIMESVLCVQYTEEPRIRNIIQQAIDAGEVPSYNAFVKESKQKMNARKRRAQEEAKEAEMSRKELGLDEGVDSLKAAIQSRQKDRQKEMDNFLAQMEAKYCKSSKGGGKKSALKKEKK

Approximately 35 kDa, based on SDS-PAGE under reducing conditions.

≥ 80%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.22 μm filtered solution of 50mM Tris-HCl (pH7.5), 200mM NaCl, 20% glycerol, 1mM DTT.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.