Copy Link Print Information

DNAJC9 Protein, Human (His, Strep)

Customer Review

Based on 1 Customer Validation

DNAJC9 Protein, Human (His, Strep) is the recombinant human-derived DNAJC9, expressed by E. coli , with Strep, His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • DNAJC9 Protein, Human (His, Strep) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

DNAJC9 Protein, Human (His, Strep) is the recombinant human-derived DNAJC9, expressed by E. coli , with Strep, His labeled tag.

Background

DNAJC9 functions as both a histone chaperone and a heat shock co-chaperone. As a histone chaperone, it forms a complex with MCM2 and histone H3-H4 heterodimers, aiding MCM2 in recognizing histone H3-H4 and facilitating histone assembly into nucleosomes. It may also act as a histone co-chaperone alongside TONSL and recruit histone chaperones such as ASF1A, NASP, and SPT2 to histone H3-H4 heterodimers. Additionally, DNAJC9 serves as a co-chaperone for HSP70 family molecular chaperones (e.g., HSPA1A, HSPA1B, and HSPA8), potentially playing a role in recruiting the HSP70 chaperone machinery to histone H3-H4 substrates to maintain histone structural integrity. In vitro, it demonstrates the ability to assemble histones onto DNA.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His;N-StrepⅡ
  • Accession

    Q8WXX5 (G2-K260)

  • Gene ID
    23234
  • Protein Length

    Partial

  • Synonyms

    DNAJC9; DnaJ (Hsp40) Homolog, Subfamily C, Member 9; DnaJ Heat Shock Protein Family (Hsp40) Member C9; DnaJ Homolog Subfamily C Member 9; JDD1; DnaJ Protein SB73; SB73; HDJC9

  • AA Sequence

    GLLDLCEEVFGTADLYRVLGVRREASDGEVRRGYHKVSLQVHPDRVGEGDKEDATRRFQILGKVYSVLSDREQRAVYDEQGTVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAFEKTYKGSEEELADIKQAYLDFKGDMDQIMESVLCVQYTEEPRIRNIIQQAIDAGEVPSYNAFVKESKQKMNARKRRAQEEAKEAEMSRKELGLDEGVDSLKAAIQSRQKDRQKEMDNFLAQMEAKYCKSSKGGGKKSALKKEKK

  • Predicted Molecular Mass

    33 kDa

  • Molecular Weight

    Approximately 35 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 80%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50mM Tris-HCl (pH7.5), 200mM NaCl, 20% glycerol, 1mM DTT.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • DNAJC9 Protein, Human (His, Strep) Product Image
    1/16
  • DNAJC9 Protein, Human (His, Strep) Product Image