DRD3 Protein, Human (sf9, Flag, His)

DRD3 Protein, Human (sf9, Flag, His) is the recombinant human-derived DRD3, expressed by Sf9 insect cells , with His, Flag labeled tag. ,

DRD3 is a dopamine receptor whose activity is mediated by G proteins that inhibit adenylyl cyclase. It promotes cell proliferation.

Human

Sf9 insect cells

C-His;N-Flag

P35462-1 (M1-K221,G319-C400, L119W)

1814

Partial

GVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHVSPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC

≥ 85%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 20 mM HEPES , pH 7.5, 150 mM NaCl, 0.01% (w/v) LMNG, 0.001% (w/v) CHS.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.