DUSP14 Protein, Human (His)
Based on 1 Customer Validation
DUSP14 protein can inactivate MAP kinase and dephosphorylate ERK, JNK and p38 MAP kinase. Its negative regulation extends to TCR signaling, where DUSP14 dephosphorylates the MAP3K7 adapter TAB1, resulting in inactivation. DUSP14 Protein, Human (His-MBP) is the recombinant human-derived DUSP14 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
DUSP14 protein can inactivate MAP kinase and dephosphorylate ERK, JNK and p38 MAP kinase. Its negative regulation extends to TCR signaling, where DUSP14 dephosphorylates the MAP3K7 adapter TAB1, resulting in inactivation. DUSP14 Protein, Human (His-MBP) is the recombinant human-derived DUSP14 protein, expressed by E. coli , with N-His labeled tag.
Background
The DUSP14 Protein assumes a crucial role in the inactivation of MAP kinases, exhibiting dephosphorylation activity towards ERK, JNK, and p38 MAP-kinases. Its negative regulatory function extends to TCR signaling, where DUSP14 dephosphorylates the MAP3K7 adapter TAB1, leading to its inactivation. This mechanism underscores DUSP14's role in modulating the TCR signaling pathway, revealing its involvement in regulating immune responses. The dephosphorylation activity of DUSP14 on key components of MAP kinase cascades highlights its capacity to finely tune cellular signaling, with potential implications for various physiological processes influenced by MAP kinase pathways.
Verified Bioactivity
Measured in a cell proliferation assay using A549 cells. The ED50 for this effect is ≤8.219 ng/mL, corresponding to a specific activity is ≥1.217×105 units/mg.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
O95147 (M1-H191)
-
Molecular Construction
-
N-term
-
His
-
DUSP14 (M1-H191)
Accession # O95147 -
C-term
-
-
Protein Length
Partial
-
Synonyms
DUSP14; MAP Kinase Phosphatase 6; Dual Specificity Phosphatase 14; MKP-6; MKP-L; CDNA, FLJ95796, Homo Sapiens Dual Specificity Phosphatase 14 (DUSP14), MRNA; MKP6; Dual Specificity Phosphatase 14, Isoform CRA_a; Mitogen-Activated Protein Kinase Phosphatas
-
AA Sequence
MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRH
-
Molecular Weight
Approximately 60 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose, 8% mannitol, 0.02% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
