E-Selectin/CD62E Protein, Rat (HEK293, His)

The E-selectin/CD62E protein is a cell surface glycoprotein that critically mediates immune adhesion by promoting neutrophil adhesion to cytokine-activated endothelial cells through the SELPLG/PSGL1 interaction. It may also contribute to capillary morphogenesis and interact with SELPLG/PSGL1 and PODXL2 via the sialyl Lewis X epitope regardless of SELPLG sulfation. E-Selectin/CD62E Protein, Rat (HEK293, His) is the recombinant rat-derived E-Selectin/CD62E protein, expressed by HEK293 , with C-His labeled tag. The total length of E-Selectin/CD62E Protein, Rat (HEK293, His) is 473 a.a., with molecular weight of ~75-96 kDa.

E-Selectin/CD62E protein, a cell-surface glycoprotein, plays a pivotal role in immunoadhesion by mediating the adhesion of blood neutrophils to cytokine-activated endothelium through interaction with SELPLG/PSGL1. Beyond its immunological function, E-Selectin may contribute to capillary morphogenesis. The protein engages in interactions with SELPLG/PSGL1 and PODXL2 through the sialyl Lewis X epitope, with the noteworthy observation that SELPLG sulfation seems dispensable for this interaction. These findings underscore the diverse roles of E-Selectin in facilitating cellular adhesion events and suggest its potential involvement in processes related to vascular development.

Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. When 5 x 10⁴ cells/well are added to Rat E-Selectin/Fc Chimera coated plates (2 µg/mL with 100 µL/well), approximately 96.12% will adhere for 1 hour incubation at 37°C.

Rat

HEK293

C-His

P98105 (W22-P494)

25544  [NCBI]

WYYNASSELMTYDEASAYCQRDYTHLVAIQNKEEINYLNSTLRYSPSYYWIGIRKVNNVWIWVGTQKPLTEEAKNWAPGEPNNKQRNEDCVEIYIQRPKDSGMWNDERCDKKKLALCYTASCTNTSCSGHGECVETINSYTCKCHPGFLGPKCDQVVTCQEQEYPDHGSLNCTHPFGLFSYNSSCSFSCERGYVPSSMETTVRCTSSGEWSAPAPACHVVECKALTQPAHGVRKCSSNPGSYPWNTTCTFDCEEGYRRVGAQNLQCTSSGVWDNEKPSCKAVTCDAIPRPQNGSVSCSNSTAGALAFKSSCNFTCEHSFTLQGPAQVECSAQGQWTPQIPVCKASQCEALSAPQRGHMKCLPSASAPFQSGSSCKFSCDEGFELKGSRRLQCGPRGEWDSEKPTCAGVQCSSLDLPGKMNMSCSGPAVFGTVCEFTCPEGWTLNGSSILTCGATGRWSAMLPTCEAPANPPRP

The protein migrates as approximately 75-96 kDa under reducing SDS-PAGE due to glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.