Copy Link Print Information

E-Selectin/CD62E Protein, Rat (HEK293, His)

Customer Review

Based on 1 Customer Validation

The E-selectin/CD62E protein is a cell surface glycoprotein that critically mediates immune adhesion by promoting neutrophil adhesion to cytokine-activated endothelial cells through the SELPLG/PSGL1 interaction. It may also contribute to capillary morphogenesis and interact with SELPLG/PSGL1 and PODXL2 via the sialyl Lewis X epitope regardless of SELPLG sulfation. E-Selectin/CD62E Protein, Rat (HEK293, His) is the recombinant rat-derived E-Selectin/CD62E protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for E-Selectin/CD62E Protein, Rat (HEK293, His)
  • E-Selectin/CD62E Protein, Rat (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The E-selectin/CD62E protein is a cell surface glycoprotein that critically mediates immune adhesion by promoting neutrophil adhesion to cytokine-activated endothelial cells through the SELPLG/PSGL1 interaction. It may also contribute to capillary morphogenesis and interact with SELPLG/PSGL1 and PODXL2 via the sialyl Lewis X epitope regardless of SELPLG sulfation. E-Selectin/CD62E Protein, Rat (HEK293, His) is the recombinant rat-derived E-Selectin/CD62E protein, expressed by HEK293 , with C-His labeled tag.

Background

E-Selectin/CD62E protein, a cell-surface glycoprotein, plays a pivotal role in immunoadhesion by mediating the adhesion of blood neutrophils to cytokine-activated endothelium through interaction with SELPLG/PSGL1. Beyond its immunological function, E-Selectin may contribute to capillary morphogenesis. The protein engages in interactions with SELPLG/PSGL1 and PODXL2 through the sialyl Lewis X epitope, with the noteworthy observation that SELPLG sulfation seems dispensable for this interaction. These findings underscore the diverse roles of E-Selectin in facilitating cellular adhesion events and suggest its potential involvement in processes related to vascular development.

Verified Bioactivity

Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. When 5 x 104 cells/well are added to Rat E-Selectin/Fc Chimera coated plates (2 µg/mL with 100 µL/well), approximately 96.12% will adhere for 1 hour incubation at 37°C.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-His
  • Accession

    P98105 (W22-P494)

  • Gene ID
    25544  [NCBI]
  • Molecular Construction
    • N-term
    • CD62E (W22-P494)
      Accession # P98105
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    SELE; ESEL; Prev. ELAM1; Endothelial Adhesion Molecule 1; Prev. ELAM; ELAM-1; Endothelial Leukocyte Adhesion Molecule 1; LECAM2; CD62 Antigen-Like Family Member E; Leukocyte Endothelial Cell Adhesion Molecule 2; E-Selectin; CD62E Antigen; CD62E; Selectin-

  • AA Sequence

    WYYNASSELMTYDEASAYCQRDYTHLVAIQNKEEINYLNSTLRYSPSYYWIGIRKVNNVWIWVGTQKPLTEEAKNWAPGEPNNKQRNEDCVEIYIQRPKDSGMWNDERCDKKKLALCYTASCTNTSCSGHGECVETINSYTCKCHPGFLGPKCDQVVTCQEQEYPDHGSLNCTHPFGLFSYNSSCSFSCERGYVPSSMETTVRCTSSGEWSAPAPACHVVECKALTQPAHGVRKCSSNPGSYPWNTTCTFDCEEGYRRVGAQNLQCTSSGVWDNEKPSCKAVTCDAIPRPQNGSVSCSNSTAGALAFKSSCNFTCEHSFTLQGPAQVECSAQGQWTPQIPVCKASQCEALSAPQRGHMKCLPSASAPFQSGSSCKFSCDEGFELKGSRRLQCGPRGEWDSEKPTCAGVQCSSLDLPGKMNMSCSGPAVFGTVCEFTCPEGWTLNGSSILTCGATGRWSAMLPTCEAPANPPRP

  • Molecular Weight

    Approximately 70-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • E-Selectin/CD62E Protein, Rat (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for E-Selectin/CD62E Protein, Rat (HEK293, His)
  • E-Selectin/CD62E Protein, Rat (HEK293, His) Product Image