ECM1 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

ECM1 Protein, an extracellular matrix protein, is involved in various biological processes, including skin development, wound healing, and angiogenesis. It supports cell adhesion and migration, and regulates the structure and function of the extracellular matrix. Understanding the functions of ECM1 Protein is important for studying tissue remodeling and developing therapeutic strategies for ECM1-related disorders and diseases. ECM1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ECM1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

ECM1 Protein, an extracellular matrix protein, is involved in various biological processes, including skin development, wound healing, and angiogenesis. It supports cell adhesion and migration, and regulates the structure and function of the extracellular matrix. Understanding the functions of ECM1 Protein is important for studying tissue remodeling and developing therapeutic strategies for ECM1-related disorders and diseases. ECM1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ECM1 protein, expressed by HEK293 , with C-His labeled tag.

Background

ECM1, a multifaceted protein, serves as a crucial participant in endochondral bone formation, acting as a negative regulator of bone mineralization. Beyond its role in bone development, ECM1 demonstrates its influence on vascular processes by stimulating endothelial cell proliferation and promoting angiogenesis. Furthermore, the protein exhibits inhibitory effects on MMP9 proteolytic activity, revealing its regulatory function in extracellular matrix remodeling. ECM1 engages in various molecular interactions, including binding to HSPG2 via its C-terminus and forming complexes with EFEMP1/FBLN3 and LAMB3. Additionally, ECM1 interacts directly with MMP9, emphasizing its involvement in the modulation of matrix metalloproteinase activity. The diverse roles and interactions of ECM1 underscore its significance in orchestrating processes related to bone formation and vascular function.

Verified Bioactivity

1.Measured by the ability of the immobilized protein to support the adhesion of HFF Human skin fibroblast cells. When 5 × 104 cells/well are added to mECM1-His coated plates (2.5 μg/mL and 100 μL/well), approximately > 30% will adhere specifically after 90 minutes at 37°C.
2.Measured by the ability of the immobilized protein to support the adhesion of the B16F1 mouse melanoma cells. The adhesion rate for this effect is 69.70% in the presence of 10 μg/mL rmECM-1.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • ECM1 (A20-E559)
      Accession # Q61508
    • His
    • C-term
  • Protein Length

    Full Length of Isoform-1 Mature Protein

  • Synonyms

    ECM1; Testicular Tissue Protein Li 61; Extracellular Matrix Protein 1; ECM1 Short Variant; Secretory Component P85; URBWD

  • AA Sequence

    ASEGAFKASDQREMTPERLFQHLHEVGYAAPPSPPQTRRLRVDHSVTSLHDPPLFEEQREVQPPSSPEDIPVYEEDWPTFLNPNVDKAGPAVPQEAIPLQKEQPPPQVHIEQKEIDPPAQPQEEIVQKEVKPHTLAGQLPPEPRTWNPARHCQQGRRGVWGHRLDGFPPGRPSPDNLKQICLPERQHVIYGPWNLPQTGYSHLSRQGETLNVLETGYSRCCRCRSDTNRLDCLKLVWEDAMTQFCEAEFSVKTRPHLCCRLRGEERFSCFQKEAPRPDYLLRPCPVHQNGMSSGPQLPFPPGLPTPDNVKNICLLRRFRAVPRNLPATDAIQRQLQALTRLETEFQRCCRQGHNHTCTWKAWEGTLDGYCERELAIKTHPHSCCHYPPSPARDECFAHLAPYPNYDRDILTLDLSRVTPNLMGQLCGSGRVLSKHKQIPGLIQNMTIRCCELPYPEQACCGEEEKLAFIENLCGPRRNSWKDPALCCDLSPEDKQINCFNTNYLRNVALVAGDTGNATGLGEQGPTRGTDANPAPGSKEE

  • Molecular Weight

    Approximately 90-95 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00