EGR2 Protein, Human (His, Strep)

EGR2 Protein, Human (His, Strep) is the recombinant human-derived EGR2, expressed by E. coli , with Strep, His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

EGR2 Protein, Human (His, Strep) is the recombinant human-derived EGR2, expressed by E. coli , with Strep, His labeled tag.

Background

EGR2 is a sequence-specific DNA-binding transcription factor involved in hindbrain segmentation and Schwann cell myelination. It regulates the expression of a subset of homeobox-containing genes (e.g., HOXA4, HOXB3, and HOXB2) to specify odd and even rhombomeres in the hindbrain (By similarity). EGR2 binds to two EGR2-consensus sites, EGR2A (5'-CTGTAGGAG-3') and EGR2B (5'-ATGTAGGTG-3'), in the HOXB3 enhancer to promote HOXB3 transcriptional activation (By similarity). It also binds specific DNA sites in the promoter regions of HOXA4, HOXB2, and ERBB2 (By similarity). In the peripheral nervous system, EGR2 regulates myelination by controlling the expression of myelin proteins (e.g., MPZ) and promoting Schwann cell differentiation (By similarity). Additionally, EGR2 may play a role in the innervation of jaw-opening musculature via trigeminal motor neurons (By similarity) and potentially in adipogenesis by regulating CEBPB expression (By similarity). EGR2 also functions as an E3 SUMO-protein ligase, facilitating SUMO1 conjugation to its coregulators NAB1 and NAB2, whose sumoylation downregulates EGR2 transcriptional activity.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Strep;His
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    EGR2; KROX-20, Drosophila, Homolog (Early Growth Response-2); Prev. KROX20; Early Growth Response 2 Isoform 1; E3 SUMO-Protein Transferase ERG2; Krox-20 Homolog, Drosophila; Early Growth Response Protein 2; CMT1D; E3 SUMO-Protein Ligase EGR2; CMT4E; Zinc

  • AA Sequence

    ERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQKE

  • Predicted Molecular Mass

    13.7 kDa

  • Purity

    ≥ 85%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00