EGR2 Protein, Human (His, Strep)
EGR2 Protein, Human (His, Strep) is the recombinant human-derived EGR2, expressed by E. coli , with Strep, His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
EGR2 Protein, Human (His, Strep) is the recombinant human-derived EGR2, expressed by E. coli , with Strep, His labeled tag.
Background
EGR2 is a sequence-specific DNA-binding transcription factor involved in hindbrain segmentation and Schwann cell myelination. It regulates the expression of a subset of homeobox-containing genes (e.g., HOXA4, HOXB3, and HOXB2) to specify odd and even rhombomeres in the hindbrain (By similarity). EGR2 binds to two EGR2-consensus sites, EGR2A (5'-CTGTAGGAG-3') and EGR2B (5'-ATGTAGGTG-3'), in the HOXB3 enhancer to promote HOXB3 transcriptional activation (By similarity). It also binds specific DNA sites in the promoter regions of HOXA4, HOXB2, and ERBB2 (By similarity). In the peripheral nervous system, EGR2 regulates myelination by controlling the expression of myelin proteins (e.g., MPZ) and promoting Schwann cell differentiation (By similarity). Additionally, EGR2 may play a role in the innervation of jaw-opening musculature via trigeminal motor neurons (By similarity) and potentially in adipogenesis by regulating CEBPB expression (By similarity). EGR2 also functions as an E3 SUMO-protein ligase, facilitating SUMO1 conjugation to its coregulators NAB1 and NAB2, whose sumoylation downregulates EGR2 transcriptional activity.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Strep;His
-
Accession
P11161-1 (E337-E425)
-
Gene ID1959
-
Protein Length
Partial
-
Synonyms
EGR2; KROX-20, Drosophila, Homolog (Early Growth Response-2); Prev. KROX20; Early Growth Response 2 Isoform 1; E3 SUMO-Protein Transferase ERG2; Krox-20 Homolog, Drosophila; Early Growth Response Protein 2; CMT1D; E3 SUMO-Protein Ligase EGR2; CMT4E; Zinc
-
AA Sequence
ERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQKE
-
Predicted Molecular Mass
13.7 kDa
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)