EIF1AX Protein, Human (His)
The EIF1AX protein is an important member of the 43S preinitiation complex (43S PIC) and is responsible for coordinating mRNA cap-proximal binding, scanning the 5'-untranslated region, and pinpointing the start codon. EIF1AX Protein, Human (His) is the recombinant human-derived EIF1AX protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The EIF1AX protein is an important member of the 43S preinitiation complex (43S PIC) and is responsible for coordinating mRNA cap-proximal binding, scanning the 5'-untranslated region, and pinpointing the start codon. EIF1AX Protein, Human (His) is the recombinant human-derived EIF1AX protein, expressed by E. coli , with N-6*His labeled tag.
Background
EIF1AX is a crucial component of the 43S pre-initiation complex (43S PIC), playing a pivotal role in the initiation of protein synthesis. As part of the 43S PIC, EIF1AX binds to the mRNA cap-proximal region, facilitates scanning of the mRNA 5'-untranslated region, and locates the initiation codon. Working in concert with EIF1, EIF1AX enhances the formation of the cap-proximal complex and aids in scanning, start codon recognition, assembly of the 48S complex at the initiation codon, and dissociation of aberrant complexes. Following the location of the start codon, EIF1AX collaborates with EIF5B to orient the initiator methionine-tRNA in a conformation conducive to 60S ribosomal subunit joining, forming the 80S initiation complex. EIF1AX is released after 80S initiation complex formation, occurring just after GTP hydrolysis by EIF5B and preceding the release of EIF5B. Its globular part is situated in the A site of the 40S ribosomal subunit. Interactions with EIF5 and EIF5B during scanning contribute to the maintenance of EIF1 within the open 43S PIC, highlighting EIF1AX's multifaceted role in the complex process of translation initiation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P47813 (M1-I144)
-
Molecular Construction
-
N-term
-
6*His
-
EIF1AX (M1-I144)
Accession # P47813 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
EIF1AX; Eukaryotic Translation Initiation Factor 1A, X Chromosome; Prev. EIF1A; Eukaryotic Translation Initiation Factor 1A, X-Linked; Prev. EIF4C; Putative Eukaryotic Translation Initiation Factor 1A; EIF-4C; Alternative Protein EIF1AX; Eukaryotic Transl
-
AA Sequence
MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI
-
Predicted Molecular Mass
18.6 kDa
-
Molecular Weight
Approximately 22 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
