Enoyl-ACP Reductase Protein, E. coli (His)

Enoyl-ACP Reductase Protein is a member of the Short chain Dehydrogenase Reductase (SDR) superfamily. It is a key enzyme of the type II fatty acid synthesis (FAS) system. Enoyl-ACP Reductase catalyzes the reduction of a carbon-carbon double bond in an enoyl moiety that is covalently linked to an acyl carrier protein (ACP). And it is involved in the elongation cycle of fatty acid which are used in the lipid metabolism and in the biotin biosynthesis. Enoyl-ACP Reductase Protein, E. coli (His) is the recombinant E. coli-derived Enoyl-ACP Reductase protein, expressed by E. coli , with N-His labeled tag. The total length of Enoyl-ACP Reductase Protein, E. coli (His) is 261 a.a., with molecular weight of ~30 kDa.

Enoyl-ACP Reductase is a member of the Short chain Dehydrogenase Reductase (SDR) superfamily and thus are closely related to the other SDR enzyme of the fatty acid synthesis cycle, 3-ketoacyl-ACP reductase, in both structure and mechanism. Enoyl-ACP Reductase is a key enzyme of the type II fatty acid synthesis (FAS) system. Fatty acid biosynthesis is essential for survival in mammals, plants, fungi and bacteria (the archaea make isoprenoid-based lipids). Enoyl-ACP Reductase catalyzes the reduction of a carbon-carbon double bond in an enoyl moiety that is covalently linked to an acyl carrier protein (ACP). And it is involved in the elongation cycle of fatty acid which are used in the lipid metabolism and in the biotin biosynthesis^[1][2].

Enzymatic activity is determined by following NADH consumption. The specific activity is 1055.75 pmol/min/μg.

E.coli

E. coli

N-6*His

WP_000506490 (G2-K262)

/

GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELELK

Approximately 30 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.