ENSA Protein, Human (Biotinylated, His)
ENSA protein is a key phosphatase inhibitor that precisely controls PP2A activity during mitosis by inhibiting PP2A. Phosphorylation of Ser-67 in mitosis promotes specific interaction with PPP2R2D, leading to inactivation of PP2A. ENSA Protein, Human (Biotinylated, His) is the recombinant human-derived ENSA protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
ENSA protein is a key phosphatase inhibitor that precisely controls PP2A activity during mitosis by inhibiting PP2A. Phosphorylation of Ser-67 in mitosis promotes specific interaction with PPP2R2D, leading to inactivation of PP2A. ENSA Protein, Human (Biotinylated, His) is the recombinant human-derived ENSA protein, expressed by E. coli , with N-His labeled tag.
Background
ENSA protein, a pivotal phosphatase inhibitor, exerts precise control over protein phosphatase 2A (PP2A) during mitosis, specifically inhibiting its activity. Phosphorylation at Ser-67 during mitosis facilitates a specific interaction with PPP2R2D (PR55-delta), leading to the inactivation of PP2A. This orchestrated inactivation of PP2A is crucial for maintaining high cyclin-B1-CDK1 activity during the M phase, underscoring ENSA's regulatory role in cell cycle progression. Beyond its mitotic functions, ENSA also operates as a stimulator of insulin secretion by interacting with the sulfonylurea receptor (ABCC8), preventing sulfonylurea binding and reducing K(ATP) channel currents. Notably, ENSA's interactions with PPP2R2D and ABCC8 highlight its diverse roles in both cell cycle control and insulin secretion regulation, showcasing its significance in maintaining cellular homeostasis and functional integrity. Additionally, ENSA's interaction with SNCA, disrupted upon phosphorylation at Ser-109, further emphasizes its dynamic involvement in cellular processes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
O43768-1 (M1-E121)
-
Molecular Construction
-
N-term
-
His
-
ENSA (M1-E121)
Accession # O43768-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Conjugation
Biotin
-
Synonyms
ENSA; MGC78563; Endosulfine Alpha; MGC4319; ARPP-19e; MGC8394; Alpha-Endosulfine
-
AA Sequence
MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE
-
Predicted Molecular Mass
15.2 kDa
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)