EphA6 Protein, Human (HEK293, His)
Based on 1 Customer Validation
EphA6 Protein, a receptor tyrosine kinase, engages in promiscuous binding with GPI-anchored ephrin-A ligands, facilitating contact-dependent bidirectional signaling. EphA6 mediates intricate signaling exchanges between cells, playing a crucial role in diverse cellular processes through both forward and reverse signaling pathways. EphA6 Protein, Human (HEK293, His) is the recombinant human-derived EphA6 protein, expressed by HEK293 , with C-10*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
EphA6 Protein, a receptor tyrosine kinase, engages in promiscuous binding with GPI-anchored ephrin-A ligands, facilitating contact-dependent bidirectional signaling. EphA6 mediates intricate signaling exchanges between cells, playing a crucial role in diverse cellular processes through both forward and reverse signaling pathways. EphA6 Protein, Human (HEK293, His) is the recombinant human-derived EphA6 protein, expressed by HEK293 , with C-10*His labeled tag.
Background
The EphA6 protein, a receptor tyrosine kinase, exhibits promiscuous binding to GPI-anchored ephrin-A family ligands on adjacent cells, initiating contact-dependent bidirectional signaling into neighboring cells. The downstream pathway originating from the receptor is termed forward signaling, while the pathway downstream of the ephrin ligand is referred to as reverse signaling, as indicated by similarity to other Eph receptors. This interaction highlights EphA6's role in mediating intricate signaling exchanges between cells, contributing to diverse cellular processes through bidirectional communication.
Verified Bioactivity
Immobilized Recombinant Human FGF21 Protein at 2 μg/mL (100 μL/well) can bind Recombinant Human Ephrin-A3 / EFNA3 / EFL2 Protein (Fc Tag), the EC50 is 20-150 ng/mL.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-10*His
-
Accession
Q9UF33-1 (W23-V550)
-
Gene ID285220
-
Molecular Construction
-
N-term
-
EphA6 (W23-V550)
Accession # Q9UF33-1 -
10*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
EPHA6; HEK12; EPH Receptor A6; EHK2; Ephrin Type-A Receptor 6; EK12; EPH Homology Kinase 2; Receptor Protein-Tyrosine Kinase; EPH-Like Kinase 12; Ephrin Receptor EphA6; FLJ35246; PRO57066; EHK-2; EPA6
-
AA Sequence
WPGDCSHVSNNQVVLLDTTTVLGELGWKTYPLNGWDAITEMDEHNRPIHTYQVCNVMEPNQNNWLRTNWISRDAAQKIYVEMKFTLRDCNSIPWVLGTCKETFNLFYMESDESHGIKFKPNQYTKIDTIAADESFTQMDLGDRILKLNTEIREVGPIERKGFYLAFQDIGACIALVSVRVFYKKCPFTVRNLAMFPDTIPRVDSSSLVEVRGSCVKSAEERDTPKLYCGADGDWLVPLGRCICSTGYEEIEGSCHACRPGFYKAFAGNTKCSKCPPHSLTYMEATSVCQCEKGYFRAEKDPPSMACTRPPSAPRNVVFNINETALILEWSPPSDTGGRKDLTYSVICKKCGLDTSQCEDCGGGLRFIPRHTGLINNSVIVLDFVSHVNYTFEIEAMNGVSELSFSPKPFTAITVTTDQDAPSLIGVVRKDWASQNSIALSWQAPAFSNGAILDYEIKYYEKEHEQLTYSSTRSKAPSVIITGLKPATKYVFHIRVRTATGYSGYSQKFEFETGDETSDMAAEQGQILV
-
Predicted Molecular Mass
60.6 kDa
-
Molecular Weight
Approximately 64 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.2 μm filtered solution of PBS, 0.02% tween 80, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
