EphA6 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
EphA6 Protein, a receptor tyrosine kinase, engages in promiscuous binding with GPI-anchored ephrin-A ligands, facilitating contact-dependent bidirectional signaling. EphA6 mediates intricate signaling exchanges between cells, playing a crucial role in diverse cellular processes through both forward and reverse signaling pathways. EphA6 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EphA6 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
EphA6 Protein, a receptor tyrosine kinase, engages in promiscuous binding with GPI-anchored ephrin-A ligands, facilitating contact-dependent bidirectional signaling. EphA6 mediates intricate signaling exchanges between cells, playing a crucial role in diverse cellular processes through both forward and reverse signaling pathways. EphA6 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EphA6 protein, expressed by HEK293 , with C-His labeled tag.
Background
The EphA6 protein, a receptor tyrosine kinase, exhibits promiscuous binding to GPI-anchored ephrin-A family ligands on adjacent cells, initiating contact-dependent bidirectional signaling into neighboring cells. The downstream pathway originating from the receptor is termed forward signaling, while the pathway downstream of the ephrin ligand is referred to as reverse signaling, as indicated by similarity to other Eph receptors. This interaction highlights EphA6's role in mediating intricate signaling exchanges between cells, contributing to diverse cellular processes through bidirectional communication.
Verified Bioactivity
1.This product does not contain protein kinase domain.
2.Measured by its binding ability in a functional ELISA. Immobilized recombinant mouse EphA6 at 2 μg/mL(100 μL/well) can bind biotinylated recombinant mouse EphrinA3. The ED50 for this effect is 42.95 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
Q62413 (W23-Q546)
-
Molecular Construction
-
N-term
-
EphA6 (W23-Q546)
Accession # Q62413 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
EPHA6; HEK12; EPH Receptor A6; EHK2; Ephrin Type-A Receptor 6; EK12; EPH Homology Kinase 2; Receptor Protein-Tyrosine Kinase; EPH-Like Kinase 12; Ephrin Receptor EphA6; FLJ35246; PRO57066; EHK-2; EPA6
-
AA Sequence
WTGDCSHVSNQVVLLDTTTVMGELGWKTYPLNGWDAITEMDEHNRPIHTYQVCNVMEPNQNNWLRTNWISRDAAQKIYVEMKFTLRDCNSIPWVLGTCKETFNLYYIESDESHGTKFKPSQYIKIDTIAADESFTQMDLGDRILKLNTEIREVGPIERKGFYLAFQDIGACIALVSVRVFYKKCPFTVRNLAMFPDTIPRVDSSSLVEVRGSCVKSAEERDTPKLYCGADGDWLVPLGRCICSTGYEEIEGSCHACRPGFYKAFAGNTKCSKCPPHSSTYVEATSVCHCEKGYFRAEKDPPSMACTRPPSAPRNVAFNINETALILEWSPPSDTGGRKDLTYSVICKKCGLDTTQCEDCGGGLRFIPRHTGLINNSVVVLDFVSHVNYTFEIEAMNGVSELSISPKPFTAITVTTDHDAPSLIGMMRKDWASQNSLALSWQAPAFSNGAILDYEIKYYEKEHEQLTYSSTRSKAPSVIVTGLKPATTYIFHIRVRTATGYSGYSQKFEFETGDETSDMAAEQGQ
-
Predicted Molecular Mass
58.6 kDa
-
Molecular Weight
Approximately 70 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (239 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)