EphB1 Protein, Human

The EphB1 protein is a receptor tyrosine kinase that promiscuously binds to the transmembrane ephrin-B ligand of adjacent cells, initiating bidirectional signaling. The forward signal originates from the receptor and the reverse signal originates from the ephrin ligand. EphB1 Protein, Human is the recombinant human-derived EphB1, expressed by E. coli, with tag-free. The total length of EphB1 Protein, Human is 295 a.a..

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The EphB1 protein is a receptor tyrosine kinase that promiscuously binds to the transmembrane ephrin-B ligand of adjacent cells, initiating bidirectional signaling. The forward signal originates from the receptor and the reverse signal originates from the ephrin ligand. EphB1 Protein, Human is the recombinant human-derived EphB1, expressed by E. coli, with tag-free. The total length of EphB1 Protein, Human is 295 a.a..

Background

The EphB1 protein, a receptor tyrosine kinase, engages in promiscuous binding to transmembrane ephrin-B family ligands on adjacent cells, initiating contact-dependent bidirectional signaling. The downstream pathway originating from the receptor is known as forward signaling, while the signaling pathway downstream of the ephrin ligand is termed reverse signaling. Cognate/functional ephrin ligands for this receptor include EFNB1, EFNB2, and EFNB3. In nervous system development, EphB1 regulates retinal axon guidance by redirecting ipsilaterally ventrotemporal retinal ganglion cell axons at the optic chiasm midline, likely through repulsive interaction with EFNB2. In the adult nervous system, in conjunction with EFNB3, EphB1 governs chemotaxis, proliferation, and polarity of hippocampal neural progenitors. Beyond its role in axon guidance, EphB1 plays a crucial redundant role with other ephrin-B receptors in the development and maturation of dendritic spines and synapse formation. Additionally, EphB1 may regulate angiogenesis and, more generally, play a role in targeted cell migration and adhesion. Upon activation by EFNB1 and possibly other ephrin-B ligands, EphB1 activates the MAPK/ERK and JNK signaling cascades to regulate cell migration and adhesion, respectively. Moreover, EphB1 is involved in maintaining the pool of satellite cells (muscle stem cells) by promoting their self-renewal and reducing their activation and differentiation.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    EPHB1; ELK; Prev. EPHT2; EK6; Hek6; Receptor Protein-Tyrosine Kinase; Neuronally-Expressed EPH-Related Tyrosine Kinase; Eph Tyrosine Kinase 2; Tyrosine-Protein Kinase Receptor EPH-2; EPH Tyrosine Kinase 2; Ephrin Type-B Receptor 1; EphB1; EPH-Like Kinase

  • AA Sequence

    DPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVATITA

  • Purity

    ≥ 80%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00