EphB1 Protein, Human
The EphB1 protein is a receptor tyrosine kinase that promiscuously binds to the transmembrane ephrin-B ligand of adjacent cells, initiating bidirectional signaling. The forward signal originates from the receptor and the reverse signal originates from the ephrin ligand. EphB1 Protein, Human is the recombinant human-derived EphB1, expressed by E. coli, with tag-free. The total length of EphB1 Protein, Human is 295 a.a..
- Species: Human
- Source: E. coli
Biological Activity
The EphB1 protein is a receptor tyrosine kinase that promiscuously binds to the transmembrane ephrin-B ligand of adjacent cells, initiating bidirectional signaling. The forward signal originates from the receptor and the reverse signal originates from the ephrin ligand. EphB1 Protein, Human is the recombinant human-derived EphB1, expressed by E. coli, with tag-free. The total length of EphB1 Protein, Human is 295 a.a..
The EphB1 protein, a receptor tyrosine kinase, engages in promiscuous binding to transmembrane ephrin-B family ligands on adjacent cells, initiating contact-dependent bidirectional signaling. The downstream pathway originating from the receptor is known as forward signaling, while the signaling pathway downstream of the ephrin ligand is termed reverse signaling. Cognate/functional ephrin ligands for this receptor include EFNB1, EFNB2, and EFNB3. In nervous system development, EphB1 regulates retinal axon guidance by redirecting ipsilaterally ventrotemporal retinal ganglion cell axons at the optic chiasm midline, likely through repulsive interaction with EFNB2. In the adult nervous system, in conjunction with EFNB3, EphB1 governs chemotaxis, proliferation, and polarity of hippocampal neural progenitors. Beyond its role in axon guidance, EphB1 plays a crucial redundant role with other ephrin-B receptors in the development and maturation of dendritic spines and synapse formation. Additionally, EphB1 may regulate angiogenesis and, more generally, play a role in targeted cell migration and adhesion. Upon activation by EFNB1 and possibly other ephrin-B ligands, EphB1 activates the MAPK/ERK and JNK signaling cascades to regulate cell migration and adhesion, respectively. Moreover, EphB1 is involved in maintaining the pool of satellite cells (muscle stem cells) by promoting their self-renewal and reducing their activation and differentiation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P54762-1 (D602-A896)
-
Gene ID2047
-
Protein Length
Partial
-
Synonyms
EPHB1; EPH receptor B1; EphB1 , EPHT2; ephrin type-B receptor 1; Hek6; EK6; EPH-like kinase 6; eph tyrosine kinase 2; soluble EPHB1 variant 1; tyrosine-protein kinase receptor EPH-2; neuronally-expressed EPH-related tyrosine kinase; ELK; NET; EPHT2; FLJ37986
-
AA Sequence
DPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVATITA
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)