ETF1 Protein, Human
ETF1 Protein, Human is the recombinant human-derived ETF1, expressed by E. coli , with tag Free labeled tag.
- Species: Human
- Source: E. coli
-
Stockage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Activité biologique
Description
ETF1 Protein, Human is the recombinant human-derived ETF1, expressed by E. coli , with tag Free labeled tag.
Background
RF1 is a component of the eRF1-eRF3-GTP ternary complex, which mediates translation termination in response to stop codons. The complex binds to a stop codon in the ribosomal A-site, with ETF1/ERF1 responsible for stop codon recognition and peptidyl-tRNA hydrolysis. Following GTP hydrolysis, eRF3 dissociates, allowing ETF1/eRF1 to fully occupy the A-site and facilitate peptidyl-tRNA hydrolysis. RF1 is also part of the transient SURF complex, recruiting UPF1 to stalled ribosomes during nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. Additionally, RF1 is required for SHFL-mediated translation termination, which inhibits programmed ribosomal frameshifting (-1PRF) in viral and cellular mRNAs. by similar: Functional mechanisms of the eRF1-eRF3-GTP complex and its role in translation termination.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P62495-1 (S141-L275)
-
Gene ID2107
-
Protein Length
Partial
-
Synonyms
ETF1; Eukaryotic Peptide Chain Release Factor Subunit 1; Prev. ERF1; Polypeptide Chain Release Factor 1; Prev. SUP45L1; Protein Cl1; Prev. ERF; Eukaryotic Release Factor 1; TB3-1; D5S1995; RF1; Eukaryotic Translation Termination Factor 1; Sup45 (Yeast Omn
-
AA Sequence
SDDSKFGFIVIDGSGALFGTLQGNTREVLHKFTVDLPKKHGRGGQSALRFARLRMEKRHNYVRKVAETAVQLFISGDKVNVAGLVLAGSADFKTELSQSDMFDQRLQSKVLKLVDISYGGENGFNQAIELSTEVL
-
Predicted Molecular Mass
14.8 kDa
-
Pureté
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)