ETF1 Protein, Human
ETF1 Protein, Human is the recombinant human-derived ETF1, expressed by E. coli , with tag Free labeled tag.
- Species: Human
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
ETF1 Protein, Human is the recombinant human-derived ETF1, expressed by E. coli , with tag Free labeled tag.
RF1 is a component of the eRF1-eRF3-GTP ternary complex, which mediates translation termination in response to stop codons. The complex binds to a stop codon in the ribosomal A-site, with ETF1/ERF1 responsible for stop codon recognition and peptidyl-tRNA hydrolysis. Following GTP hydrolysis, eRF3 dissociates, allowing ETF1/eRF1 to fully occupy the A-site and facilitate peptidyl-tRNA hydrolysis. RF1 is also part of the transient SURF complex, recruiting UPF1 to stalled ribosomes during nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. Additionally, RF1 is required for SHFL-mediated translation termination, which inhibits programmed ribosomal frameshifting (-1PRF) in viral and cellular mRNAs. by similar: Functional mechanisms of the eRF1-eRF3-GTP complex and its role in translation termination.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P62495-1 (S141-L275)
-
Gene ID2107
-
Protein Length
Partial
-
Synonyms
ERF1; RF1; SUP45L1
-
AA Sequence
SDDSKFGFIVIDGSGALFGTLQGNTREVLHKFTVDLPKKHGRGGQSALRFARLRMEKRHNYVRKVAETAVQLFISGDKVNVAGLVLAGSADFKTELSQSDMFDQRLQSKVLKLVDISYGGENGFNQAIELSTEVL
-
Predicted Molecular Mass
14.8 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
