ETF1 Protein, Human

ETF1 Protein, Human is the recombinant human-derived ETF1, expressed by E. coli , with tag Free labeled tag.

RF1 is a component of the eRF1-eRF3-GTP ternary complex, which mediates translation termination in response to stop codons. The complex binds to a stop codon in the ribosomal A-site, with ETF1/ERF1 responsible for stop codon recognition and peptidyl-tRNA hydrolysis. Following GTP hydrolysis, eRF3 dissociates, allowing ETF1/eRF1 to fully occupy the A-site and facilitate peptidyl-tRNA hydrolysis. RF1 is also part of the transient SURF complex, recruiting UPF1 to stalled ribosomes during nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. Additionally, RF1 is required for SHFL-mediated translation termination, which inhibits programmed ribosomal frameshifting (-1PRF) in viral and cellular mRNAs. by similar: Functional mechanisms of the eRF1-eRF3-GTP complex and its role in translation termination.

Human

E. coli

Tag Free

P62495-1 (S141-L275)

2107

Partial

SDDSKFGFIVIDGSGALFGTLQGNTREVLHKFTVDLPKKHGRGGQSALRFARLRMEKRHNYVRKVAETAVQLFISGDKVNVAGLVLAGSADFKTELSQSDMFDQRLQSKVLKLVDISYGGENGFNQAIELSTEVL

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl (pH 7.5), 200 mM NaCl, 20% glycerol, 1 mM DTT.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.