FASN Protein, Human (His)

FASN Protein, Human (His) is the recombinant human-derived FASN protein, expressed by E. coli, with N-His tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

FASN Protein, Human (His) is the recombinant human-derived FASN protein, expressed by E. coli, with N-His tag.

Background

Fatty Acid Synthase (FASN) is a multifunctional enzyme crucial for the de novo biosynthesis of long-chain saturated fatty acids, utilizing acetyl-CoA and malonyl-CoA in the presence of NADPH. This versatile protein possesses seven catalytic activities and a binding site for the prosthetic group 4'-phosphopantetheine of the acyl carrier protein (ACP) domain. Significantly, FASN plays a pivotal role in the replication of SARS coronavirus-2 (SARS-CoV-2), the virus responsible for COVID-19, as its enzymatic activity is required for the viral replication process.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    FASN; 3-Oxoacyl-[Acyl-Carrier-Protein] Reductase; Fatty Acid Synthase; 3-Oxoacyl-[Acyl-Carrier-Protein] Synthase; FAS; Enoyl-[Acyl-Carrier-Protein] Reductase; SDR27X1; Acyl-[Acyl-Carrier-Protein] Hydrolase; Short Chain Dehydrogenase/Reductase Family 27X,

  • AA Sequence

    LACPTPKEDGLAQQQTQLNLRSLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLAEPRVSVREG

  • Predicted Molecular Mass

    58.3 kDa

  • Molecular Weight

    Approximately 34-39 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00