FASN Protein, Human (His)
FASN Protein, Human (His) is the recombinant human-derived FASN protein, expressed by E. coli, with N-His tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
FASN Protein, Human (His) is the recombinant human-derived FASN protein, expressed by E. coli, with N-His tag.
Background
Fatty Acid Synthase (FASN) is a multifunctional enzyme crucial for the de novo biosynthesis of long-chain saturated fatty acids, utilizing acetyl-CoA and malonyl-CoA in the presence of NADPH. This versatile protein possesses seven catalytic activities and a binding site for the prosthetic group 4'-phosphopantetheine of the acyl carrier protein (ACP) domain. Significantly, FASN plays a pivotal role in the replication of SARS coronavirus-2 (SARS-CoV-2), the virus responsible for COVID-19, as its enzymatic activity is required for the viral replication process.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
NP_004095-1 (L2200-G2511)
-
Gene ID2194
-
Protein Length
Partial
-
Synonyms
FASN; 3-Oxoacyl-[Acyl-Carrier-Protein] Reductase; Fatty Acid Synthase; 3-Oxoacyl-[Acyl-Carrier-Protein] Synthase; FAS; Enoyl-[Acyl-Carrier-Protein] Reductase; SDR27X1; Acyl-[Acyl-Carrier-Protein] Hydrolase; Short Chain Dehydrogenase/Reductase Family 27X,
-
AA Sequence
LACPTPKEDGLAQQQTQLNLRSLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLAEPRVSVREG
-
Predicted Molecular Mass
58.3 kDa
-
Molecular Weight
Approximately 34-39 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
