Fc epsilon RIA/FCER1A Protein, Human (HEK293)
Based on 1 Customer Validation
The Fc epsilon RIA/FCER1A protein is a high-affinity receptor for IgE and critically mediates IgE effector function in myeloid cells. After binding to IgE and cross-linking with antigen, it activates signaling pathways that induce myeloid cell activation and differentiation. Fc epsilon RIA/FCER1A Protein, Human (HEK293) is the recombinant human-derived Fc epsilon RIA/FCER1A protein, expressed by HEK293, with tag free.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The Fc epsilon RIA/FCER1A protein is a high-affinity receptor for IgE and critically mediates IgE effector function in myeloid cells. After binding to IgE and cross-linking with antigen, it activates signaling pathways that induce myeloid cell activation and differentiation. Fc epsilon RIA/FCER1A Protein, Human (HEK293) is the recombinant human-derived Fc epsilon RIA/FCER1A protein, expressed by HEK293, with tag free.
Background
Fc epsilon RIA/FCER1A Protein takes center stage as a high-affinity receptor designed for immunoglobulin epsilon/IgE, serving as a crucial mediator of IgE effector functions in myeloid cells. Upon binding to IgE and subsequent cross-linking with antigens/allergens, it activates signaling pathways that induce myeloid cell activation and differentiation. Particularly on mast cells, basophils, and eosinophils, Fc epsilon RIA triggers the secretion of vasoactive amines, lipid mediators, and cytokines, contributing to inflammatory responses, tissue remodeling, and cytotoxicity against microbes. This orchestrated response forms a part of the immediate hypersensitivity reaction to allergens, acting as a host defense mechanism against helminth parasites, pathogenic bacteria, and venom toxicity. However, when dysregulated, this receptor can lead to harmful and life-threatening allergic and anaphylactic reactions. Structurally, it exists as a tetramer comprising an alpha chain, a beta chain, and two disulfide-linked gamma chains, and it interacts with IGHE via the CH3 region.
Verified Bioactivity
Immobilized Recombinant Human Fc epsilon RIA/FCER1A at 2 μg/mL (100 μl/well) can bind Recombinant Human IgE-Fc Protein, the ED50 is 9-90 ng/mL.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
P12319 (V26-Q205)
-
Gene ID2205
-
Protein Length
Extracellular Domain
-
Synonyms
FCER1A; FcepsilonRI Alpha Chain; Prev. FCE1A; FcERI; FcepsilonRIalpha; Immunoglobulin E Receptor, High-Affinity, Of Mast Cells, Alpha Polypeptide; FCERIA; High Affinity Immunoglobulin Epsilon Receptor Alpha-Subunit; Fc Fragment Of IgE, High Affinity I, Re
-
AA Sequence
VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ
-
Predicted Molecular Mass
21 kDa
-
Molecular Weight
Approximately 43 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)