Fc epsilon RIA/FCER1A Protein, Human (HEK293)

Customer Review

Based on 1 Customer Validation

The Fc epsilon RIA/FCER1A protein is a high-affinity receptor for IgE and critically mediates IgE effector function in myeloid cells. After binding to IgE and cross-linking with antigen, it activates signaling pathways that induce myeloid cell activation and differentiation. Fc epsilon RIA/FCER1A Protein, Human (HEK293) is the recombinant human-derived Fc epsilon RIA/FCER1A protein, expressed by HEK293, with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The Fc epsilon RIA/FCER1A protein is a high-affinity receptor for IgE and critically mediates IgE effector function in myeloid cells. After binding to IgE and cross-linking with antigen, it activates signaling pathways that induce myeloid cell activation and differentiation. Fc epsilon RIA/FCER1A Protein, Human (HEK293) is the recombinant human-derived Fc epsilon RIA/FCER1A protein, expressed by HEK293, with tag free.

Background

Fc epsilon RIA/FCER1A Protein takes center stage as a high-affinity receptor designed for immunoglobulin epsilon/IgE, serving as a crucial mediator of IgE effector functions in myeloid cells. Upon binding to IgE and subsequent cross-linking with antigens/allergens, it activates signaling pathways that induce myeloid cell activation and differentiation. Particularly on mast cells, basophils, and eosinophils, Fc epsilon RIA triggers the secretion of vasoactive amines, lipid mediators, and cytokines, contributing to inflammatory responses, tissue remodeling, and cytotoxicity against microbes. This orchestrated response forms a part of the immediate hypersensitivity reaction to allergens, acting as a host defense mechanism against helminth parasites, pathogenic bacteria, and venom toxicity. However, when dysregulated, this receptor can lead to harmful and life-threatening allergic and anaphylactic reactions. Structurally, it exists as a tetramer comprising an alpha chain, a beta chain, and two disulfide-linked gamma chains, and it interacts with IGHE via the CH3 region.

Verified Bioactivity

Immobilized Recombinant Human Fc epsilon RIA/FCER1A at 2 μg/mL (100 μl/well) can bind Recombinant Human IgE-Fc Protein, the ED50 is 9-90 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag Tag Free
  • Accession
  • Gene ID
  • Protein Length

    Extracellular Domain

  • Synonyms

    FCER1A; FcepsilonRI Alpha Chain; Prev. FCE1A; FcERI; FcepsilonRIalpha; Immunoglobulin E Receptor, High-Affinity, Of Mast Cells, Alpha Polypeptide; FCERIA; High Affinity Immunoglobulin Epsilon Receptor Alpha-Subunit; Fc Fragment Of IgE, High Affinity I, Re

  • AA Sequence

    VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ

  • Predicted Molecular Mass

    21 kDa

  • Molecular Weight

    Approximately 43 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00