1. Recombinant Proteins
  2. Fc Receptors
  3. Fc-gamma Receptor
  4. Fc gamma RIV/CD16-2
  5. FcgR4/CD16-2 Protein, Mouse (HEK293, His)

The FcγR4/CD16-2 protein is an IgG receptor with moderate affinity for IgG2a and IgG2b. It recognizes virus-specific IgG, triggers antibody-dependent cellular cytotoxicity, and provides protection against fatal influenza infection. FcgR4/CD16-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived FcgR4/CD16-2 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The FcγR4/CD16-2 protein is an IgG receptor with moderate affinity for IgG2a and IgG2b. It recognizes virus-specific IgG, triggers antibody-dependent cellular cytotoxicity, and provides protection against fatal influenza infection. FcgR4/CD16-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived FcgR4/CD16-2 protein, expressed by HEK293 , with C-His labeled tag.

Background

The FcγR4/CD16-2 Protein serves as a receptor for the constant Fc fragment of immunoglobulin gamma (IgG), exhibiting intermediate affinity for both IgG2a and IgG2b. It recognizes neutralizing virus-specific IgGs on infected cells, triggering antibody-dependent cellular cytotoxicity (ADCC) and conferring protection against lethal influenza virus infection. On splenic dendritic cells, FcγR4 efficiently uptakes antigen immune complexes, directing them into MHC class I and II antigen presentation pathways, thereby enhancing CD4-positive and CD8-positive T cell immune responses. Additionally, FcγR4 plays a crucial role in mediating neutrophil activation by IgG complexes, acting redundantly with FCGR2A. It contributes to bone resorption by enhancing osteoclast differentiation upon binding to IgG2a. Furthermore, FcγR4 functions as a receptor for the Fc region of immunoglobulin epsilon (IgE), binding to both a and b allotypes of IgE and promoting macrophage-mediated phagocytosis, antigen presentation to T cells, and the late phase of cutaneous allergic reactions. It forms a heterooligomeric complex with ITAM-containing signaling subunits FCER1G and interacts with the Fc region of antigen-complexed IgG.

Biological Activity

1. Measured by its binding ability in a functional ELISA.Immobilized mouse FCGR4 at 10 μg/mL (100 μl/well) can bind recombinant human IgG1 (Fc) . The EC50 of human IgG1 (Fc) is 0.11-0.25 μg/mL.
2. Measured by its binding ability in a functional ELISA. Immobilized Mouse CD16-2 at 10 μg/mL (100 μL/well) on the plate can bind Biotinylated Human IgG1 (HY-P73903). The ED50 for this effect is 0.656 μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Mouse CD16-2 at 10 μg/mL (100 μL/well) on the plate can bind Biotinylated Human IgG1 (HY-P73903). The ED50 for this effect is 0.656 μg/mL.
Species

Mouse

Source

HEK293

Tag

C-His

Accession

A0A0B4J1G0 (G21-Q203)

Gene ID
Molecular Construction
N-term
FcgR4 (Q19-Q203)
Accession # A0A0B4J1G0
His
C-term
Protein Length

Partial

Synonyms
Low affinity immunoglobulin gamma Fc region receptor IV; CD16-2; FcgammaRIV; Fcrl3
AA Sequence

GLQKAVVNLDPKWVRVLEEDSVTLRCQGTFSPEDNSIKWFHNESLIPHQDANYVIQSARVKDSGMYRCQTALSTISDPVQLEVHMGWLLLQTTKWLFQEGDPIHLRCHSWQNRPVRKVTYLQNGKGKKYFHENSELLIPKATHNDSGSYFCRGLIGHNNKSSASFRISLGDPGSPSMFPPWHQ

Predicted Molecular Mass
21.9 kDa
Molecular Weight

Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FcgR4/CD16-2 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

FcgR4/CD16-2 Protein, Mouse (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FcgR4/CD16-2 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P76918
Quantity:
MCE Japan Authorized Agent: