FcgR4/CD16-2 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
The FcγR4/CD16-2 protein is an IgG receptor with moderate affinity for IgG2a and IgG2b. It recognizes virus-specific IgG, triggers antibody-dependent cellular cytotoxicity, and provides protection against fatal influenza infection. FcgR4/CD16-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived FcgR4/CD16-2 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The FcγR4/CD16-2 protein is an IgG receptor with moderate affinity for IgG2a and IgG2b. It recognizes virus-specific IgG, triggers antibody-dependent cellular cytotoxicity, and provides protection against fatal influenza infection. FcgR4/CD16-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived FcgR4/CD16-2 protein, expressed by HEK293 , with C-His labeled tag.
Background
The FcγR4/CD16-2 Protein serves as a receptor for the constant Fc fragment of immunoglobulin gamma (IgG), exhibiting intermediate affinity for both IgG2a and IgG2b. It recognizes neutralizing virus-specific IgGs on infected cells, triggering antibody-dependent cellular cytotoxicity (ADCC) and conferring protection against lethal influenza virus infection. On splenic dendritic cells, FcγR4 efficiently uptakes antigen immune complexes, directing them into MHC class I and II antigen presentation pathways, thereby enhancing CD4-positive and CD8-positive T cell immune responses. Additionally, FcγR4 plays a crucial role in mediating neutrophil activation by IgG complexes, acting redundantly with FCGR2A. It contributes to bone resorption by enhancing osteoclast differentiation upon binding to IgG2a. Furthermore, FcγR4 functions as a receptor for the Fc region of immunoglobulin epsilon (IgE), binding to both a and b allotypes of IgE and promoting macrophage-mediated phagocytosis, antigen presentation to T cells, and the late phase of cutaneous allergic reactions. It forms a heterooligomeric complex with ITAM-containing signaling subunits FCER1G and interacts with the Fc region of antigen-complexed IgG.
Verified Bioactivity
1. Measured by its binding ability in a functional ELISA.Immobilized mouse FCGR4 at 10 μg/mL (100 μl/well) can bind recombinant human IgG1 (Fc) . The EC50 of human IgG1 (Fc) is 0.11-0.25 μg/mL.
2. Measured by its binding ability in a functional ELISA. Immobilized Mouse CD16-2 at 10 μg/mL (100 μL/well) on the plate can bind Biotinylated Human IgG1 (HY-P73903). The ED50 for this effect is 0.656 μg/mL.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
A0A0B4J1G0 (G21-Q203)
-
Molecular Construction
-
N-term
-
FcgR4 (Q19-Q203)
Accession # A0A0B4J1G0 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
Low affinity immunoglobulin gamma Fc region receptor III-A; IgG Fc receptor III-A; CD16-2; FcgammaRIV; CD16a; Fcgr4; Fcgr3a
-
AA Sequence
GLQKAVVNLDPKWVRVLEEDSVTLRCQGTFSPEDNSIKWFHNESLIPHQDANYVIQSARVKDSGMYRCQTALSTISDPVQLEVHMGWLLLQTTKWLFQEGDPIHLRCHSWQNRPVRKVTYLQNGKGKKYFHENSELLIPKATHNDSGSYFCRGLIGHNNKSSASFRISLGDPGSPSMFPPWHQ
-
Predicted Molecular Mass
21.9 kDa
-
Molecular Weight
Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)