FGF-14 Protein, Human (isoform 1B)
FGF-14 Protein likely plays a crucial role in the development and functioning of the nervous system, contributing to intricate processes underlying neural structure and activity. Its interaction with SCN8A suggests potential involvement in modulating this sodium channel's activity, emphasizing its intricate role in neurophysiology. FGF-14 Protein, Human (isoform 1B) is the recombinant human-derived FGF-14 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
FGF-14 Protein likely plays a crucial role in the development and functioning of the nervous system, contributing to intricate processes underlying neural structure and activity. Its interaction with SCN8A suggests potential involvement in modulating this sodium channel's activity, emphasizing its intricate role in neurophysiology. FGF-14 Protein, Human (isoform 1B) is the recombinant human-derived FGF-14 protein, expressed by E. coli , with tag free.
Background
The FGF-14 protein likely plays a crucial role in the development and functioning of the nervous system, contributing to the intricate processes that underlie neural structure and activity. Its interaction with SCN8A further suggests potential involvement in modulating the activity of this sodium channel, emphasizing its intricate role in neurophysiology.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q92915-2/NP_787125.1 (K64-T252)
-
Molecular Construction
-
N-term
-
FGF-14 (K64-T252)
Accession # Q92915-2/NP_787125.1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
FGF14; Nystagmus 4, Congenital Autosomal Dominant; Fibroblast Growth Factor 14; Fibroblast Growth Factor; FHF4; SCA27A; SCA27; SCA27B; Fibroblast Growth Factor Homologous Factor 4; NYS4; FGF-14; FGF; FHF-4
-
AA Sequence
KNKNPTDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKTT
-
Predicted Molecular Mass
21.1 kDa
-
Molecular Weight
Approximately 18kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
