1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-14
  6. FGF-14 Protein, Human (isoform 1B)

FGF-14 Protein likely plays a crucial role in the development and functioning of the nervous system, contributing to intricate processes underlying neural structure and activity. Its interaction with SCN8A suggests potential involvement in modulating this sodium channel's activity, emphasizing its intricate role in neurophysiology. FGF-14 Protein, Human (isoform 1B) is the recombinant human-derived FGF-14 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FGF-14 Protein likely plays a crucial role in the development and functioning of the nervous system, contributing to intricate processes underlying neural structure and activity. Its interaction with SCN8A suggests potential involvement in modulating this sodium channel's activity, emphasizing its intricate role in neurophysiology. FGF-14 Protein, Human (isoform 1B) is the recombinant human-derived FGF-14 protein, expressed by E. coli , with tag free.

Background

The FGF-14 protein likely plays a crucial role in the development and functioning of the nervous system, contributing to the intricate processes that underlie neural structure and activity. Its interaction with SCN8A further suggests potential involvement in modulating the activity of this sodium channel, emphasizing its intricate role in neurophysiology.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q92915-2/NP_787125.1 (K64-T252)

Gene ID
Molecular Construction
N-term
FGF-14 (K64-T252)
Accession # Q92915-2/NP_787125.1
C-term
Protein Length

Partial

Synonyms
Fibroblast growth factor 14; FHF-4; FGF14
AA Sequence

KNKNPTDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKTT

Predicted Molecular Mass
21.1 kDa
Molecular Weight

Approximately 18kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

FGF-14 Protein, Human (isoform 1B) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

FGF-14 Protein, Human (isoform 1B)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-14 Protein, Human (isoform 1B)
Cat. No.:
HY-P75193
Quantity:
MCE Japan Authorized Agent: