FGF2 Protein, Chicken (His)
Based on 1 publication(s) in Google Scholar
FGF2 Protein acts as a ligand for FGFR1-4 and an integrin ligand for FGF2 signaling. It regulates cell survival, division, differentiation, and migration. FGF2 Protein is a strong mitogen and can induce angiogenesis. FGF2 Protein, Chicken (His) is the recombinant FGF2 protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Others
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
FGF2 Protein acts as a ligand for FGFR1-4 and an integrin ligand for FGF2 signaling. It regulates cell survival, division, differentiation, and migration. FGF2 Protein is a strong mitogen and can induce angiogenesis. FGF2 Protein, Chicken (His) is the recombinant FGF2 protein, expressed by E. coli , with C-6*His labeled tag.
Background
The FGF2 protein serves as a ligand for FGFR1, FGFR2, FGFR3, and FGFR4, as well as an integrin ligand necessary for FGF2 signaling. It plays a crucial role in regulating cell survival, division, differentiation, and migration. Additionally, FGF2 functions as a potent mitogen in vitro and has the ability to induce angiogenesis.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Cell Death Discov
Circ_0020256 induces fibroblast activation to drive cholangiocarcinoma development via recruitment of EIF4A3 protein to stabilize KLF4 mRNA. [Abstract]2023 May 13;9(1):161. PMID: 37179359
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag C-6*His
-
Accession
P48800 (P13-S158)
-
Gene ID396413 [NCBI]
-
Molecular Construction
-
N-term
-
FGF2 (P13-S158)
Accession # P48800 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
FGF2; BFGF; Prev. FGFB; Basic Fibroblast Growth Factor; Fibroblast Growth Factor 2 (Basic); Fibroblast Growth Factor; Heparin-Binding Growth Factor 2; Prostatropin; HBGF-2; FGF2A; FGF-2; FGF; Fibroblast Growth Factor 2; Basic Fibroblast Growth Factor BFGF
-
AA Sequence
PALPDDGGGGAFPPGHFKDPKRLYCKNGGFFLRINPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSANRFLAMKEDGRLLALKCATEECFFFERLESNNYNTYRSRKYSDWYVALKRTGQYKPGPKTGPGQKAILFLPMSAKS
-
Predicted Molecular Mass
23.2 kDa
-
Molecular Weight
Approximately 27 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (233 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)