1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. FGFBP2 Protein, Human (sf9, His)

The FGFBP2 protein is secreted by cytotoxic T lymphocytes and binds reversibly to acidic and basic fibroblast growth factors. It also binds to the basement membrane glycans. FGFBP2 is highly expressed in human malignant cells and normal tissues and is a potential prognostic biomarker for tumors. FGFBP2 Protein, Human (sf9, His) is the recombinant human-derived FGFBP2 protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The FGFBP2 protein is secreted by cytotoxic T lymphocytes and binds reversibly to acidic and basic fibroblast growth factors. It also binds to the basement membrane glycans. FGFBP2 is highly expressed in human malignant cells and normal tissues and is a potential prognostic biomarker for tumors. FGFBP2 Protein, Human (sf9, His) is the recombinant human-derived FGFBP2 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

Fibroblast growth factor binding protein 2 is a protein encoded by the FGFBP2 gene in humans. The FGFBP2 protein is secreted by cytotoxic T lymphocytes and binds reversibly to acidic and basic fibroblast growth factors. It also binds to the basement membrane glycans. FGFBP2 is highly expressed in human malignant cells and normal tissues and is a potential prognostic biomarker for tumors[1][2].

Species

Human

Source

Sf9 insect cells

Tag

C-His

Accession

Q9BYJ0 (Q20-G223)

Gene ID
Molecular Construction
N-term
FGFBP2 (Q20-G223)
Accession # Q9BYJ0
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Fibroblast growth factor-binding protein 2; Ksp37; HBp17-RP
AA Sequence

QAPRQKQGSTGEEFHFQTGGRDSCTMRPSSLGQGAGEVWLRVDCRNTDQTYWCEYRGQPSMCQAFAADPKPYWNQALQELRRLHHACQGAPVLRPSVCREAGPQAHMQQVTSSLKGSPEPNQQPEAGTPSLRPKATVKLTEATQLGKDSMEELGKAKPTTRPTAKPTQPGPRPGGNEEAKKKAWEHCWKPFQALCAFLISFFRG

Predicted Molecular Mass
22.6 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of 20mM Tris, 300mM NaCl, 10% glycerol,pH8.0
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

FGFBP2 Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

FGFBP2 Protein, Human (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGFBP2 Protein, Human (sf9, His)
Cat. No.:
HY-P77433
Quantity:
MCE Japan Authorized Agent: