FGFBP2 Protein, Human (sf9, His)
Based on 1 Customer Validation
The FGFBP2 protein is secreted by cytotoxic T lymphocytes and binds reversibly to acidic and basic fibroblast growth factors. It also binds to the basement membrane glycans. FGFBP2 is highly expressed in human malignant cells and normal tissues and is a potential prognostic biomarker for tumors. FGFBP2 Protein, Human (sf9, His) is the recombinant human-derived FGFBP2 protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The FGFBP2 protein is secreted by cytotoxic T lymphocytes and binds reversibly to acidic and basic fibroblast growth factors. It also binds to the basement membrane glycans. FGFBP2 is highly expressed in human malignant cells and normal tissues and is a potential prognostic biomarker for tumors. FGFBP2 Protein, Human (sf9, His) is the recombinant human-derived FGFBP2 protein, expressed by Sf9 insect cells , with C-His labeled tag.
Fibroblast growth factor binding protein 2 is a protein encoded by the FGFBP2 gene in humans. The FGFBP2 protein is secreted by cytotoxic T lymphocytes and binds reversibly to acidic and basic fibroblast growth factors. It also binds to the basement membrane glycans. FGFBP2 is highly expressed in human malignant cells and normal tissues and is a potential prognostic biomarker for tumors[1][2].
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
Q9BYJ0 (Q20-G223)
-
Molecular Construction
-
N-term
-
FGFBP2 (Q20-G223)
Accession # Q9BYJ0 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
FGFBP2; HBp17-Related Protein; Fibroblast Growth Factor Binding Protein 2; HBp17-RP; KSP37; FGF-BP2; Killer-Specific Secretory Protein Of 37 KDa; FGFBP-2; Fibroblast Growth Factor-Binding Protein 2; HBP17RP; 37 KDa Killer-Specific Secretory Protein; Ksp37
-
AA Sequence
QAPRQKQGSTGEEFHFQTGGRDSCTMRPSSLGQGAGEVWLRVDCRNTDQTYWCEYRGQPSMCQAFAADPKPYWNQALQELRRLHHACQGAPVLRPSVCREAGPQAHMQQVTSSLKGSPEPNQQPEAGTPSLRPKATVKLTEATQLGKDSMEELGKAKPTTRPTAKPTQPGPRPGGNEEAKKKAWEHCWKPFQALCAFLISFFRG
-
Predicted Molecular Mass
22.6 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.2 μm filtered solution of 20mM Tris, 300mM NaCl, 10% glycerol,pH8.0
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
