FIBP Protein, Human
FIBP is an intracellular chaperone of acidic fibroblast growth factor (aFGF) and mediates the mitogenic effects of aFGF, affecting cell types through mitosis and inducing morphological changes and differentiation. This gene expresses two isoforms, showing potential functional diversity. FIBP Protein, Human is the recombinant human-derived FIBP protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
FIBP is an intracellular chaperone of acidic fibroblast growth factor (aFGF) and mediates the mitogenic effects of aFGF, affecting cell types through mitosis and inducing morphological changes and differentiation. This gene expresses two isoforms, showing potential functional diversity. FIBP Protein, Human is the recombinant human-derived FIBP protein, expressed by E. coli , with tag free.
The FIBP Protein plays a pivotal role as an intracellular binding partner for acidic fibroblast growth factor (aFGF), a mitogen with broad-ranging effects on various cell types, stimulating mitogenesis and inducing morphological changes and differentiation. FIBP's selective binding to aFGF suggests its potential involvement in mediating the mitogenic actions of aFGF within cells. This gene exhibits two transcript variants encoding different isoforms, highlighting the potential diversity in its functional roles. FIBP demonstrates ubiquitous expression, with prominent levels detected in the testis (RPKM 27.1), brain (RPKM 21.5), and 25 other tissues. Its widespread presence underscores its likely participation in diverse cellular processes across multiple organs.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
O43427-2/NP_004205.2 (M1-D357)
-
Molecular Construction
-
N-term
-
FIBP (M1-D357)
Accession # NP_004205.2 -
C-term
-
-
Protein Length
Full Length of Isoform-2
-
Synonyms
Acidic fibroblast growth factor intracellular-binding protein; FGF-1 intracellular-binding protein; FIBP
-
AA Sequence
MTSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVDSQMDDMDMDLDKEFLQDLKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMEANFKNLSRGLVNVAAKLTHNKDVRDLFVDLVEKFVEPCRSDHWPLSDVRFFLNQYSASVHSLDGFRHQALWDRYMGTLRGCLLRLYHD
-
Predicted Molecular Mass
41.8 kDa
-
Molecular Weight
Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
