FkpA Protein, E.coli (His-SUMO)

The FkpA protein plays a central role in cellular processes, acting as a key catalyst in the complex dance of protein folding. Its catalytic efficiency is excellent in promoting the cis-trans isomerization of proline-imine peptide bonds, thus accelerating the overall folding of proteins. FkpA Protein, E.coli (His-SUMO) ) is the recombinant E. coli-derived FkpA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

At the forefront of cellular machinery, the FkpA protein emerges as a key catalyst in expediting the intricate process of protein folding. Its catalytic prowess is particularly evident in the facilitation of cis-trans isomerization of proline imidic peptide bonds within oligopeptides. By orchestrating these precise structural changes, FkpA significantly accelerates the overall folding of proteins, unveiling its vital role in ensuring the timely and accurate formation of functional protein structures. This molecular finesse highlights FkpA's importance in the complex choreography of cellular processes, emphasizing its contribution to maintaining cellular homeostasis.

E.coli

E. coli

N-His;N-SUMO

P65764 (A26-K270)

75206290  [NCBI]

Full Length of Mature Protein

AEAAKPATTADSKAAFKNDDQKSAYALGASLGRYMENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLVFDVELLDVKPAPKADAKPEADAKAADSAKK

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.