FkpA Protein, E.coli (His-SUMO)

The FkpA protein plays a central role in cellular processes, acting as a key catalyst in the complex dance of protein folding. Its catalytic efficiency is excellent in promoting the cis-trans isomerization of proline-imine peptide bonds, thus accelerating the overall folding of proteins. FkpA Protein, E.coli (His-SUMO) ) is the recombinant E. coli-derived FkpA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.
  • Species: E.coli
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The FkpA protein plays a central role in cellular processes, acting as a key catalyst in the complex dance of protein folding. Its catalytic efficiency is excellent in promoting the cis-trans isomerization of proline-imine peptide bonds, thus accelerating the overall folding of proteins. FkpA Protein, E.coli (His-SUMO) ) is the recombinant E. coli-derived FkpA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Background

At the forefront of cellular machinery, the FkpA protein emerges as a key catalyst in expediting the intricate process of protein folding. Its catalytic prowess is particularly evident in the facilitation of cis-trans isomerization of proline imidic peptide bonds within oligopeptides. By orchestrating these precise structural changes, FkpA significantly accelerates the overall folding of proteins, unveiling its vital role in ensuring the timely and accurate formation of functional protein structures. This molecular finesse highlights FkpA's importance in the complex choreography of cellular processes, emphasizing its contribution to maintaining cellular homeostasis.

Technical Parameters

  • Species E.coli
  • Source E. coli
  • Tag N-His;N-SUMO
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His-SUMO
    • FkpA (A26-K270)
      Accession # P65764
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    FKBP-type peptidyl-prolyl cis-trans isomerase FkpA; EC:5.2.1.8; PPIase; Rotamase; fkpA; c4121

  • AA Sequence

    AEAAKPATTADSKAAFKNDDQKSAYALGASLGRYMENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLVFDVELLDVKPAPKADAKPEADAKAADSAKK

  • Predicted Molecular Mass

    42.3 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00