FkpA Protein, E.coli (His-SUMO)
The FkpA protein plays a central role in cellular processes, acting as a key catalyst in the complex dance of protein folding. Its catalytic efficiency is excellent in promoting the cis-trans isomerization of proline-imine peptide bonds, thus accelerating the overall folding of proteins. FkpA Protein, E.coli (His-SUMO) ) is the recombinant E. coli-derived FkpA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
- Species: E.coli
- Source: E. coli
-
Stockage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Activité biologique
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Activité biologique
The FkpA protein plays a central role in cellular processes, acting as a key catalyst in the complex dance of protein folding. Its catalytic efficiency is excellent in promoting the cis-trans isomerization of proline-imine peptide bonds, thus accelerating the overall folding of proteins. FkpA Protein, E.coli (His-SUMO) ) is the recombinant E. coli-derived FkpA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
At the forefront of cellular machinery, the FkpA protein emerges as a key catalyst in expediting the intricate process of protein folding. Its catalytic prowess is particularly evident in the facilitation of cis-trans isomerization of proline imidic peptide bonds within oligopeptides. By orchestrating these precise structural changes, FkpA significantly accelerates the overall folding of proteins, unveiling its vital role in ensuring the timely and accurate formation of functional protein structures. This molecular finesse highlights FkpA's importance in the complex choreography of cellular processes, emphasizing its contribution to maintaining cellular homeostasis.
Technical Parameters
-
Species E.coli
-
Source E. coli
-
Tag N-His;N-SUMO
-
Accession
P65764 (A26-K270)
-
Gene ID75206290 [NCBI]
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
FkpA (A26-K270)
Accession # P65764 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
FKBP-type peptidyl-prolyl cis-trans isomerase FkpA; EC:5.2.1.8; PPIase; Rotamase; fkpA; c4121
-
AA Sequence
AEAAKPATTADSKAAFKNDDQKSAYALGASLGRYMENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLVFDVELLDVKPAPKADAKPEADAKAADSAKK
-
Predicted Molecular Mass
42.3 kDa
-
Pureté
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Fiche technique (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Instruction de manipulation (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
