FLI1 Protein, Human
FLI1 Protein, Human is the recombinant human-derived FLI1, expressed by E. coli , with tag Free labeled tag.
- Species: Human
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
FLI1 Protein, Human is the recombinant human-derived FLI1, expressed by E. coli , with tag Free labeled tag.
FLI1 is a sequence-specific transcriptional activator that recognizes the DNA sequence 5'-C[CA]GGAAGT-3'. Its function has been demonstrated in multiple studies, including gene expression regulation. By similar research, FLI1 plays a significant role in transcriptional regulation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q01543 (P276-N399)
-
Gene ID2313
-
Protein Length
Partial
-
Synonyms
FLI1; Transcription Factor ERGB; Fli-1 Proto-Oncogene, ETS Transcription Factor; Ewing Sarcoma Breakpoint Region 2; SIC-1; ERGB Transcription Factor; EWSR2; ERGB Transcription Fuctor; FLI-1; Proto-Oncogene Fli-1; Friend Leukemia Integration 1 Transcriptio
-
AA Sequence
PGSGQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPTESSMYKYPSDISYMPSYHAHQQKVN
-
Predicted Molecular Mass
14.7 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
