FNDC1 Protein, Human (His)
Based on 1 Customer Validation
FNDC1 protein potentially activates G protein signaling. FNDC1 Protein, Human (His) is the recombinant human-derived FNDC1 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
FNDC1 protein potentially activates G protein signaling. FNDC1 Protein, Human (His) is the recombinant human-derived FNDC1 protein, expressed by E. coli , with N-His labeled tag.
Background
FNDC1 protein is suggested to function as an activator of G protein signaling.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-8*His
-
Accession
Q4ZHG4-1 (A33-T457)
-
Molecular Construction
-
N-term
-
8*His
-
FNDC1 (A33-T457)
Accession # Q4ZHG4-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
FNDC1; Fibronectin Type III Domain-Containing Protein 1; Prev. FNDC2; Expressed In Synovial Lining Protein; BA243O10.1; Activation-Associated CDNA Protein; DJ322A24.1; MEL4B3; KIAA1866; AGS8; Fibronectin Type III Domain Containing 1; Fibronectin Type III
-
AA Sequence
AAASVDHPLKPRHVKLLSTKMGLKVTWDPPKDATSRPVEHYNIAYGKSLKSLKYIKVNAETYSFLIEDVEPGVVYFVLLTAENHSGVSRPVYRAESPPGGEWIEIDGFPIKGPGPFNETVTEKEVPNKPLRVRVRSSDDRLSVAWKAPRLSGAKSPRRSRGFLLGYGESGRKMNYVPLTRDERTHEIKKLASESVYVVSLQSMNSQGRSQPVYRAALTKRKISEEDELDVPDDISVRVMSSQSVLVSWVDPVLEKQKKVVASRQYTVRYREKGELARWDYKQIANRRVLIENLIPDTVYEFAVRISQGERDGKWSTSVFQRTPESAPTTAPENLNVWPVNGKPTVVAASWDALPETEGKVKEYILSYAPALKPFGAKSLTYPGDTTSALVDGLQPGERYLFKIRATNRRGLGPHSKAFIVAMPTT
-
Predicted Molecular Mass
48.7 kDa
-
Molecular Weight
Approximately 50-55 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM PB, 500 mM NaCl, 10% Glycerol.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
